KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1097Help
Entry
SPy_1097          CDS       T00050                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898002..898604
Genome map
AA seq 200 aa AA seqDB search
MKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGK
DPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARA
VEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTAR
GLYKESRAERQEVISLMTKD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaaaaagca
gaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaaggtctt
cttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactgggaaaa
gatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtgattgtc
aaagacattagtttttattctatatgtgaacaccacttagttcctttttatggcaaggct
catatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcgcgagca
gttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaatagcggat
gctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagagcacatg
tgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccactgccaga
ggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgacaaaagat
tag

DBGET integrated database retrieval system