KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1111Help
Entry
SPy_1111          CDS       T00050                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPy_1111
Enzymes [BR:spy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPy_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(910144..911193)
Genome map
AA seq 349 aa AA seqDB search
MKAATYLSTGNLQLIDKPKPVIIKPTDAIVQLVKTTICGTDLHILGGDVPACKEGTILGH
EGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCQDGGWILGHLINGTQA
EYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKPGDNVCIVGAGPVGL
AALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKAIIDDITNGRGVDIS
MECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNITLNTGLVNANTTEML
LNVLKTGKIDATRLITHHFKLSEVEKAYETFKHAGANNALKVIIDNDIS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaacttacctttcaaccggaaatctacagctcatagacaaaccaaaacca
gtcattataaagcctacagatgctatcgtccagttggtaaaaaccactatttgtggaact
gatttgcatatcttaggtggggatgttcccgcatgtaaagaaggaacaatccttggtcat
gaaggaattggaattgttaaggaggtcggtgatgcggttactaactttaaaatcggagat
aaagtgattatttcttgcgtcacatcatgtcatacctgttattattgtaaacgaggcctt
tcgtcacattgtcaagatggcggttggattcttggccatttaattaatggaacacaagca
gaatatgtccatatcccacatgcagatggtagtctctatcatgctcctgatacgattgat
gatgaggcacttgtcatgctttctgatattttaccaacttcatatgaaattggtgtcttg
ccatcacatgtcaagcctggagataatgtttgtattgttggtgccggtccagtaggactc
gcagccctactaaccgttcaatttttctctccagccaatattattatggtcgacttatct
caaaatcgccttgaagcagctaaaacatttggagccacacacacgatttgttcaggaagt
agtgaagaagtcaaggctatcattgacgatataaccaatggacgtggtgtcgatatttcc
atggagtgtgttggttatcccgcgacatttgatatttgtcaaaaaattatatcagtaggt
gggcatattgctaacgttggggttcatgggaaaccagttgatttcaacctggatgaatta
tggattaaaaatatcaccttaaacactggacttgttaatgccaatacaactgaaatgcta
ctaaatgtcttgaaaactggaaagattgacgcaacaagacttattacacatcattttaaa
ctttcagaagttgaaaaagcttatgaaacctttaaacatgctggtgcaaataacgccttg
aaagttattattgataatgatattagctaa

DBGET integrated database retrieval system