KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1302Help
Entry
SPy_1302          CDS       T00050                                 

Gene name
amyA
Definition
cyclomaltodextrin glucanotransferase (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Brite
Enzymes [BR:spy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     SPy_1302 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1079593..1081728)
Genome map
AA seq 711 aa AA seqDB search
MRELHIKTYKLLTKSAVLLGLISFPLTVSAADNASVTNKADFSTDTIYQIVTDRFNDGNT
SNNGKTDVFDKNDLKKYHGGDWQGIIAKIKDGYLTDMGISAIWISSPVENIDSIDPSNGS
AAYHGYWAKDFFKTNQHFGTEADFQQLVKVAHQHHIKVVIDFAPNHTSTAEKEGTTFKED
GALYKNGKLVGKFSDDKDKIFNHESWTDFSTYENSIYHSMYGLADLNNINPKVDQYMKEA
IDKWLDLGVDGIRVDAVKHMSQGWQKNWLSHIYEKHNVFVFGEWFSGHTDDDYDMTTFAN
NSGMGLLDFRFANAIRQLYTGFSTFTMRDFYKVLENRDQVTNEVTDQVTFIDNHDMERFA
TKVANNQTAVNQAYALLLTSRGVPNIYYGTEQYATGDKDPNNRGDMPSFNKESQAYKVIS
KLAPLRKQNQALAYGTTEQRWISDHVLVFERKFGNHVALVAINRDQTNGYTITNAKTALP
QNSYKDKLEGLLGGQELIVGADGTISSFELGAGQVAVWTYEGEDKTPQLGDVDASVGIAG
NKITISGQGFGNSKGQVTFGEISAEILSWSDTLITLKVPTVPANYYNISVTTADKQTSNS
YQAFEVLTDKQIPVRLLINDFKTVPGEQLYLMGDVFEMGANDAKNAVGPLFNNTQTIAKY
PNWFFDTHLPINKEIAVKLVKKDSIGNVLWTSPETYSIKTGHEAQTITIKK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagagaattacatatcaaaacttataagttattaacgaaaagtgctgttttacttggc
ttaatttcatttccactaactgtttctgctgccgataatgcttctgtcaccaacaaagca
gatttttcaacagatacgatttatcagattgtaacagatcgttttaacgatggtaatacc
tctaataatggtaagactgatgtttttgataaaaatgaccttaaaaaataccatggaggt
gattggcaaggaatcatcgccaagattaaggatggttacctgacagatatggggatttct
gccatttggatttcttctcctgttgaaaatatcgacagtattgatccttctaatggaagt
gctgcatatcatgggtattgggctaaggacttctttaaaacaaaccagcattttggcact
gaagcagactttcaacaactagtcaaagtagctcatcaacaccatattaaggtagttatt
gattttgctcctaatcatacgtctacagccgaaaaagaaggcacaactttcaaagaagat
ggcgctttatataaaaacggtaaattagttggtaaattttcagatgataaagacaagatt
tttaatcatgaatcttggaccgattttagtacttatgaaaattctatttatcattcaatg
tacggactagctgatttaaataacattaatccgaaagttgaccagtacatgaaagaagct
attgataaatggttagacctgggtgttgatggtatccgagttgacgctgttaaacatatg
tcacaaggttggcaaaaaaattggttgagtcatatctatgaaaaacataatgtctttgtt
ttcggggaatggttctcgggacataccgacgatgattatgatatgacgacatttgctaac
aatagtgggatggggcttttagattttagatttgccaatgctattagacagttgtataca
ggtttttcaacgtttaccatgcgagatttttacaaggttcttgaaaatagagatcaggtg
actaatgaagtgacagaccaggtgacctttattgataatcatgatatggaacgcttcgca
acaaaagtggctaataatcaaactgctgttaatcaagcctatgctttgcttttaacatct
agaggtgtgcctaatatttattatggtacagagcagtatgcaacaggtgataaagatcct
aataatcgtggtgatatgccaagttttaataaagagtcacaagcctataaagtgattagt
aagctagctcctttaagaaaacaaaatcaagctttagcttatggaacaactgaacaacgt
tggattagtgatcatgttttggtatttgagcgtaaatttggtaatcatgtcgcactagtg
gctattaatagagatcaaacgaatggttatacaattactaatgctaaaacagccttgccc
caaaatagctacaaggacaaattagaaggtcttcttggcggtcaagaattaatagttgga
gcagatggcactattagtagctttgaacttggagcggggcaagtcgctgtatggacttat
gaaggagaggacaagacaccacaacttggagatgtcgatgcttcagtgggtattgctgga
aataagattactatttcaggtcaaggttttggtaattctaaaggtcaagtgacttttgga
gaaatctctgctgagatcctttcttggtcagatacccttatcaccttaaaagtaccgacg
gttccagcaaattattataacatttcagtgacaactgccgataagcaaaccagcaatagt
taccaagcctttgaagtattgactgataaacaaattcctgttcgtttactcatcaatgat
tttaagacagtaccaggggaacaactatatctcatgggtgatgtttttgagatgggggca
aatgacgctaagaatgctgttggtcctctatttaataacactcagaccattgccaagtac
ccaaactggttctttgatactcatctaccaatcaataaagaaatagcagtcaaacttgtt
aaaaaagatagtattgggaatgttttatggacaagtcctgagacttatagtataaagaca
ggtcatgaagcacaaaccattactataaaaaaataa

DBGET integrated database retrieval system