KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1328Help
Entry
SPy_1328          CDS       T00050                                 

Gene name
bglA.2
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102494..1103894)
Genome map
AA seq 466 aa AA seqDB search
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL
IVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEPIVPVECGY
LGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAYPRSNAPED
VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN
YYQPLRVQAPSKSQQEGDLLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALNLKEHY
GNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaaaacaccgttatcaatttccagatggctttttatggggaagttccaca
tctgggcctcaaagcgaaggaacggttcctggagatggcaaaggacctagcaactgggat
tactggtttagtattgagtcagctaagtttcatcaccaaattggtccagaaaaaacctca
accttttatgaaaactataagggtgacattgcccttttgaaagaaacaggccacacgatt
tttcggacctcaatccagtggtctcgattgattccagaaggagtcggggaggttaatcca
aaggcggtgacattttaccgagaagtatttcaagacattattgctcaaggtattaaattg
attgttaacctctatcattttgacctcccctatgccttgcaagaaaaaggtggctgggaa
aacaaagctactgtctgggcttatgaaacctacgcaaaaacctgttttgagctttttggt
gatttagtaaacacttggattacctttaatgaaccgattgttccagtcgaatgtggctat
ttaggttattatcactacccttgtaaagtagatgccaaggcagcagttcaagtggcttac
aacacacaactggccagttcactggcggtcaaagcttgtcataagcttcatcccgaccac
aagattagtattgtgcttaacatgacacctgcttatcctcggagtaatgctcctgaagat
gtcaaggctgctagaatcgcagagcttttccaaaccaaatccttcctagatccatcagtt
ttgggtgtttacccagcagagttagtttccattttagaggaagctgatttattacctcaa
tatagtgctgatgaattagagattatcaaaaacaatactgttgattttttgggagttaat
tattatcagcctttgcgggttcaggcacctagtaagtcacagcaagagggggacctcctt
atcttagatatttattttgaaccttatgatatgcctggtaaaaaagtcaatcctcaccgg
ggttgggaaatttatgaaccaggactttatgatattgcccttaatttaaaagaacactat
ggtaacatcgaatggctagtcacggaaaatggtatgggtgtcgaaggtgaagaagctttt
ttagcagatggccagatacaagatgactaccgcatcacctttatcgaggatcatcttatc
cagcttcataaggctttgggagaaggagccaactgcaaaggctacctcttgtggactttt
attgattgctggtcttggttaaatgcttataaaaaccgatatggtttggtagctttggat
ttagagagtcaaaagcgaaccataaaaaaatcaggttactggtttaaggcgttgagcgag
tcaaatggttttgataaatag

DBGET integrated database retrieval system