KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1429Help
Entry
SPy_1429          CDS       T00050                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPy_1429 (gpmA)
   01230 Biosynthesis of amino acids
    SPy_1429 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPy_1429 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPy_1429 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPy_1429 (gpmA)
Enzymes [BR:spy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPy_1429 (gpmA)
Exosome [BR:spy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPy_1429 (gpmA)
  Exosomal proteins of melanoma cells
   SPy_1429 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1184752..1185447)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFCDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaattttgtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtcactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system