KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1505Help
Entry
SPy_1505          CDS       T00050                                 

Gene name
phr
Definition
deoxyribodipyrimidine photolyase (EC:4.1.99.3)
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235043..1236452)
Genome map
AA seq 469 aa AA seqDB search
MVSVMWFRRDLRIDDQKALAHAIASQSPTLCVFQFNKEQLNLLHSRNQSSFITSVLAFRK
LLKCEGIDLYLMYGDLMTCFEQLLTQLKDWTDVYFNYDESGYGRLRDQKAAQFFKKNGIA
VHTYQDHYLHGSQEIINQSGQPYKVFTPYYRIWQNYPKETPIKVELSQGRWLNLETPDDV
LRTVESFKDEKYQDVATFDEASKQLNRFIQDQLAAYHANRDFPAQLGTSRLSPFLRIGAI
GIRTVYHAVRQAPNSLGQATFLKELAWRDFYNMVYVAYPDQKTQPIQKAFSQIEWVNNPD
WFQLWKEGKTGYPIVDAAMLQLQKTGWMHNRLRMIVASFLTKDLLCDWRLGEQYFQQQLI
DYDAASNIGGWQWAASTGTDAVPYFRIFNPVTQGKRFDPKGEFIKAYLPQLEHVPEKYLH
EPWKMPKNLQESVSCIIGTDYPQPIVDHAKQREQAIAKYEWAKEKAKIE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagtgatgtggtttcgtagagatttaaggattgatgatcaaaaagctttagct
catgctattgctagtcaatcaccaaccttatgtgtgtttcaatttaacaaggagcaatta
aatctgctacatagtcggaatcaatctagttttattactagcgttttggcttttagaaag
ttattaaaatgtgaaggtattgacttatatctaatgtatggagacttaatgacctgtttt
gagcaattattgacacaattaaaagactggacagatgtgtattttaactatgatgaatct
ggatatggtcgtttacgtgatcaaaaagcagcacaatttttcaaaaaaaatgggattgct
gttcatacctaccaagatcactatttacatggtagtcaagagatcattaaccaatcaggt
cagccttataaagtttttacgccctactataggatttggcaaaattatccgaaagagact
cctattaaagtagaactatcgcaaggcaggtggttaaatcttgagacaccagatgatgtt
ttaaggactgttgagagttttaaagatgaaaaatatcaggatgttgcaacttttgatgaa
gcgtcaaaacaactaaatcgatttattcaagaccaattagcagcttatcacgctaatcga
gattttccagcgcagctagggacgagtcggttgtctccttttttaagaataggagctatt
ggcattcgcacggtatatcacgctgtgcgtcaagcaccaaatagtctagggcaagctact
tttttaaaagaattagcttggagagacttttacaatatggtctatgtggcttatcctgat
cagaaaactcagcctatccaaaaagccttttctcaaatcgaatgggttaataatcctgac
tggtttcagttgtggaaagaaggtaaaacgggttaccctattgtcgatgctgcaatgctt
cagttacaaaagacaggatggatgcataatcgtttacgaatgatagtagcttctttttta
actaaagatcttttatgtgattggcgtttaggagagcagtattttcaacaacaactaatt
gattatgatgctgccagtaatatcggaggatggcagtgggctgcttccactggaacagat
gctgttccttattttagaatatttaatcctgttactcaaggtaagcgctttgatcctaaa
ggcgagtttattaaagcgtatttgcctcaactagaacacgttccagagaagtatctccac
gaaccgtggaagatgccaaaaaaccttcaagagagtgtgtcctgtattattggcacagac
tatcctcaaccaattgtcgatcatgctaaacaacgtgaacaagctattgcaaagtatgag
tgggcaaaagaaaaagcaaaaatagaatga

DBGET integrated database retrieval system