KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1586Help
Entry
SPy_1586          CDS       T00050                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPy_1586
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPy_1586
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPy_1586
Enzymes [BR:spy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPy_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303364..1306870)
Genome map
AA seq 1168 aa AA seqDB search
MVYRQKSSEIVTRTITKPSRATSNVKQEIDMTPDSKEQTVTGYQYHYIDQEGRKQPFNQG
WRFLMADVACAQDPSFDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVL
DEVLAGCHVAITFEGSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVTFGAENLLAVRVE
NKVPSSRWYSGSGLYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQSI
QTCHYQLSLCLWEQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHL
YDLELTLYYQGQVIDCFCLETGFRQLTFMANQGLFVNGRAVKLKGVCLHHDQGGLGACAY
EDALARQLVLLKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDF
SNYFHQTIGTENANYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSAD
VSHYPELTRQMCQWITAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIG
LNYADGKDYDRLHEEHSDWLLYGSETVSAITSRAYYKETKKVLDSGYHLTSYDHAKVDWG
AFASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAG
FPKDSYYFYQSQWAQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGN
LTDYGRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKS
IPKTSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSRGELVSHAQDWLQVQV
EGPARLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKASQQLSSVFQ
TQVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKTTQFLSVLENKDTQQKAGKAS
TPHILITSYQHYLSLPLQVCSQAFDFKKGDDIFLPQWLQVKDAQGSLVKKAFSMTWYLKE
KIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLAASQKRLTYCYQY
DTVQAIGAISLQNHTGTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDILTV
LYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcgccaaaagagttcagagatcgttacaaggacaattaccaagccatcaagg
gcgaccagtaacgtcaaacaggagattgatatgacaccagatagcaaggagcagacagtg
actggctaccaataccactatattgatcaagaaggaagaaagcagccctttaatcaaggc
tggcgttttcttatggcagatgtggcgtgtgctcaggacccttcttttgatgattcgaac
tggcaggtgattcatttaccacatgatttcagtcttacgcagccttacacaagaaatggt
gaagctgaaagtgcttataaattaggtggtgtcggttggtatcggcattatctcgtgtta
gatgaggttttagctggttgtcatgttgccattacttttgagggttcctatatggaaacg
gaaatttatgttaacgggcaattcattggcaaacacttaaatggctatcaggaatttact
tatgatatctctgatgttgtgacttttggagctgaaaatcttctggctgtccgggttgaa
aacaaggttcccagttctcgttggtattcaggcagtggtctttatcgtgaagtgagtttg
tctgttcttccccagcttcattttgtggcagaccaggtagcaatgaccttggctgatact
gctgtgcaggagaaagggcaacagaaagttgatttacgctttgccctcaatcagtctatt
cagacttgccactaccaattgagcctctgtttatgggaacaatcacattgctcaaaagac
aagaaactcctttatcaagaaacagaagtgcctctagctgatttggctttccaaagacag
tatggtcttacactgtctttggaagaactccaattgtggtcaccagataatcctcacctc
tacgatttagaactcactctttactatcaaggtcaggtcattgattgcttttgccttgaa
actggttttcgtcagctgacttttatggccaatcaggggctttttgtgaatggcagagct
gtcaaattaaagggagtttgtttgcatcatgaccaaggaggcctaggagcttgtgcttac
gaagatgccctagccagacaattagtcctgttgaaagacatgggggctaataccattcgt
agcacccataacccaagtagtcccaaacttaggcaactagccaatcgtctcggctttttt
gtgattgaagaagcctttgacacctggacctatgccaaaaatggaaacgttaatgacttt
tcaaactatttccatcagactatcggaactgaaaatgcaaactatcttcaaagagtgagg
tcacctgaaacgagctgggcccagtatagtattgaggccatggtctggtctgccaagaat
gacccgtcagtgttgatgtggtcgattggtaatgaattgatggagggtttttcagccgat
gtcagtcattacccagagctgacaagacaaatgtgccaatggattactgctattgacacc
tcacgtcccattacctttggggacaataaattaaaagaagctgacttttgctggcatgag
gaagtgtcgcaaatggcaactcttcttagtcaattagaccatcctcagggactcattggg
ttaaactatgctgatggaaaagactatgataggcttcatgaggagcactctgattggctg
ttgtatggttctgaaacagtctcagccattaccagcagggcttattataaagagacaaaa
aaagttcttgactccggttatcacctaacctcttatgatcatgctaaggttgattggggt
gccttcgctagccaggcttggtatgataccattacccgtgattttgttgctggcgaatgc
gtttggacaggctttgattatttaggagaacctaccccctggaacaagatcgacagcggt
gttgtaggcctttggccttctcctaaaaatgcctactttggcattttagacacggcaggc
tttccaaaagatagctattatttttaccaaagtcagtgggcgcaggggcagaccaccttg
cacctgttaccagtctggcagaaggaccagctttgtttcgatgagcagggattggtggag
gttgtggtttatagcaatgctgccagtgtgcaactgatgtttgaagatgagcagggcaac
ttaacagattatggaaggaaggcatttcatacttatagcacgccaacgggacacacttat
cagctttaccaaggagctgacgctgctaagaatcctcacgagaacctttacctgacttgg
cgagtgccctatcaaaaagggttgctaagggcagtggcctacgacatttctggtaaaagc
attccaaaaaccagtggacgttctcaggttagaacctatggttcagtggcaaagctatct
tggaaagcctttgaagcacctattgacgctccttgggaattgctttatctggatttatca
ctcttggatagccgaggtgaattggtcagccatgctcaagattggttgcaggttcaagta
gaaggaccagcccgtttgttggctcttgataatgggaatccgactgaccacaccccttat
caggagcctctgcgccaggcatatgggggaaaattattagccattttagccctcactgga
gaggcgggacacattaaggtcacggcaaaagcctcgcagcaacttagcagtgtttttcag
acacaagtagcctgccgtgcccccaaagaacacttagtgacactacctttagagaaatat
cagtttaaaaagagccgactgacaagtcaacaagaaattggtcaatcttgtctaaagacc
acacaattcctttctgttttggagaacaaagacacccagcaaaaagcaggtaaggctagc
acacctcacattcttatcactagttaccagcactatttatctctgcccttgcaggtttgt
tctcaggcatttgattttaaaaaaggcgacgatatcttcttgcctcagtggctccaagtc
aaagatgcccaaggttctcttgtgaaaaaagctttttcaatgacgtggtacctaaaagag
aaaatctttgccaagcctattcttgtcacaggctatgtttcttgttttgggcaatcaata
ccggttgaggcaaggcttaacctagcacaagctagcaaaagacggcaccaggatctcagt
ttagtcgccaagcaatccctggccgcaagtcaaaaaaggctaacttattgctaccaatat
gatacggtgcaagccataggagccattagcttgcaaaatcacacaggcacatctcttagt
gtttctgtggcaatcagttatggtagtcagagctctattaagcaagaaaccttgatgcta
gctgatagccacttgagccagttagaagaggttattttcttcgatgatattttgactgtt
ttgtatctggcagtgacccttgaagtcattgaaggacctgacctaactgaagacagtatt
caaattggcctttgggatttagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system