KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1672Help
Entry
SPy_1672          CDS       T00050                                 

Gene name
proB
Definition
(RefSeq) putative gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00330  Arginine and proline metabolism
spy00332  Carbapenem biosynthesis
spy01100  Metabolic pathways
spy01130  Biosynthesis of antibiotics
spy01230  Biosynthesis of amino acids
Module
spy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPy_1672 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPy_1672 (proB)
Enzymes [BR:spy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPy_1672 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-GeneID: 901919
NCBI-ProteinID: NP_269709
UniProt: Q99YJ7
Position
complement(1386218..1387039)
Genome map
AA seq 273 aa AA seqDB search
MMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAMGF
GLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAYYQTNVSQILLTRDVVVFPESLA
NVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLSDI
DGLFDKNPTIYEDAQLRSHVANITQEIIASAGGAGSKFGTGGMLSKVQSAQMVFENKGQM
VLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcactagttca
ttagtgctaccaacaggtaaaattaatttagaaaaaatcgaccaactggcttttgtgatt
tcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatgggattt
ggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacaggcagtt
tccagtgttggtcaggtagccatgatgagtctttattcacaaatttttgcatactaccaa
accaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagtctagcc
aatgttaccaatgcttttgaaagtctgattagtttgggcattgtgccgattgttaatgaa
aacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataatgaccgt
ttatctgctgttgttgctggtattacaaaagctgatttattaatcatgttgtctgatatt
gatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagccatgtt
gctaatattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaagtttggcaca
ggtgggatgctaagtaaggtgcagtctgctcagatggtatttgaaaacaaaggacagatg
gtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaaccacta
ggcacctggttcaagcagatagaagaggtaaggcatgactga

DBGET integrated database retrieval system