KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_2119Help
Entry
SPy_2119          CDS       T00050                                 

Gene name
ruvA
Definition
(RefSeq) putative Holiday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPy_2119 (ruvA)
Enzymes [BR:spy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPy_2119 (ruvA)
DNA repair and recombination proteins [BR:spy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SPy_2119 (ruvA)
    RecFOR pathway proteins
     SPy_2119 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH HHH_3 PHA_synth_III_E
Motif
Other DBs
NCBI-GeneID: 901758
NCBI-ProteinID: NP_270043
UniProt: P66751
Position
complement(1769543..1770139)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYKAKELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
gggtttcacacggaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgctctcggttataaagcaaaagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system