KEGG   Streptococcus pyogenes A20: A20_0072Help
Entry
A20_0072          CDS       T02335                                 

Gene name
adh2
Definition
(RefSeq) aldehyde-alcohol dehydrogenase 2 (EC:1.2.1.10)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spya  Streptococcus pyogenes A20
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A20_0072 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A20_0072 (adh2)
   00620 Pyruvate metabolism
    A20_0072 (adh2)
   00650 Butanoate metabolism
    A20_0072 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    A20_0072 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    A20_0072 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A20_0072 (adh2)
   00626 Naphthalene degradation
    A20_0072 (adh2)
Enzymes [BR:spya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A20_0072 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A20_0072 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
58509..61151
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPATWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFDNLEKSVKTADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIQMNFKAQGIDENEWKEHSRELA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataatactgttgaaacaacctctgtttctgtgacaattgatgctctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttgaccaagaacaagttgat
tatatcgtagccaaagcttctgttgctgctttggatgctcacggtgaacttgctaaacat
gcttatgaagaaacaggtcgcggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtaggaattattgaagaagat
gatgtgacaggtttgacattaattgctgagccggtgggtgttatctgtgggattacacca
acaactaacccaacttcaacagctatctttaaatctttgatttcgttaaaaacacgtaat
ccaattatttttgcctttcacccatcagcacaagaatcatcagcacatgccgctcgtatt
gttcgtgatgctgctattgccgctggtgctcctgaaaattgtgtgcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgacggcattgccactatccttgcg
acaggtggaaatgcgatggttaaagcggcatactcatgtgggaaacctgcccttggggta
ggtgctggtaacgttccagcttatgttgaaaaatcagctaatatccgtcaagccgctcat
gatattgtgatgtctaaatcatttgataatggtatggtctgtgcctctgaacaagctgtt
atcatcgataaagaaatctatgacgattttgtagcagaattcaaatcttaccatacttat
tttgtaaataaaaaagaaaaagcccttcttgaagaattctgttttggtgccaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgtaggaaaaccagctacttgg
attgcagaacaagctggatttactgttccagaaggaaccaatattcttgctgcagaatgt
aaagaagtttcagaaaatgagcctttaacacgtgaaaaattatctccagtcattgctgtt
ttaaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggactcggtcactcagctgccattcatacagcagatgcagaattggcaaaagaatttgga
actagaatccgtgctatccgcgtcatctggaattcaccttctacatttggtggtatcggg
gatgtttacaatgctttcttaccatcattgactcttggttgtggttcgtatggacgtaac
gcagttggtgataacgttagtgctataaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgtgattcaatt
caatatttgcaaaaatgtcgtgacgttgaacgtgtcatgattgttacagatcacgctatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatctttgctgaagtagaaccagatccagacattacaactgttatgaaaggt
actgaattaatgcgtaccttcaaaccagacaccattattgcccttggcgggggatcccct
atggatgcagccaaagttatgtggctcttctacgagcaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgcaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctatcccaacaacttctggaacaggttcagaggtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattactcattaaca
ccaactgtagccattgttgacccagctttggtattgactgttccaggctttattgctgct
gatactggtatggacgttttgacacacgcaaccgaagcttacgtgtcacaaatggccaat
gactttacggatggtttagctcttcaagccattaaaattgtttttgataatcttgaaaaa
tcagttaaaacagccgattttgaagcacgtgaaaagatgcataatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatgggactcgtccagctaaaacggcgacatggcctaagtataattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttagggcttccagcttctacaccagaagaa
gcagtggaatcttatgcgaaagctgtttatgatctgggttgccgagttggtattcaaatg
aacttcaaagctcaaggtatcgacgaaaacgaatggaaagaacattctcgtgaattggct
taccttgcttatgaagaccaatgttcacctgctaacccacgtcttccaatggttgatcac
atgcaagaaattattgaagatgcttactatggttatgctgaacgtccaggacgacgtaag
tga

DBGET integrated database retrieval system