KEGG   Streptococcus pyogenes A20: A20_0073Help
Entry
A20_0073          CDS       T02335                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spya  Streptococcus pyogenes A20
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A20_0073 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A20_0073 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    A20_0073 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    A20_0073 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A20_0073 (adhA)
   00626 Naphthalene degradation
    A20_0073 (adhA)
Enzymes [BR:spya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A20_0073 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61403..62419
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPNIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatctt
ccaaatattggtcatggtgaagcgcttgttaaagtagaatactgtggcgtttgtcatact
gatttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaa
ggtattggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgt
gtctctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgt
gagacactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaa
tatgcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccggctcaa
gcttcttccattacttgtgctggtgtaacaacttataaagctattaaagaggcaggtgct
gctccaggccaatggattgttatctttggggctggtggccttggaaatctggctgttcaa
tacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaactt
gagttagctaaagaagttggcgcagatattttagttaacggcaaagaaattgaagatgtt
ccaggctatattcaagaaaaaaccggtggagcacatggtgttgtggtaacggctgtttct
aaagttgcttttaaccaagcaattgatagtgtccgtgccggtggaacagttgtagccgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgctccggttgtcgaaaaagttccagttgacactgctccagaagtcttt
gatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system