KEGG   Streptococcus pyogenes A20: A20_0122Help
Entry
A20_0122          CDS       T02335                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spya  Streptococcus pyogenes A20
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spya00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87237..87392
Genome map
AA seq 51 aa AA seqDB search
MDIGIPIGSDVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggatattggtataccgattggtagtgatgtgccttattgcttgctttcaggttgtgcc
caagtcactggtaaaggtgaagtggtttgtcgcattttggggctgttatcgtcttgggtg
gttttggttaaaccagattttggtatctcgacttga

DBGET integrated database retrieval system