KEGG   Streptococcus pyogenes A20: A20_0122Help
Entry
A20_0122          CDS       T02335                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spya  Streptococcus pyogenes A20
Pathway
spya00900  Terpenoid backbone biosynthesis
spya01100  Metabolic pathways
spya01110  Biosynthesis of secondary metabolites
spya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A20_0122 (ispE)
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A20_0122 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFV37215
Position
87237..87392
Genome map
AA seq 51 aa AA seqDB search
MDIGIPIGSDVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggatattggtataccgattggtagtgatgtgccttattgcttgctttcaggttgtgcc
caagtcactggtaaaggtgaagtggtttgtcgcattttggggctgttatcgtcttgggtg
gttttggttaaaccagattttggtatctcgacttga

DBGET integrated database retrieval system