KEGG   Streptococcus pyogenes A20: A20_0123Help
Entry
A20_0123          CDS       T02335                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spya  Streptococcus pyogenes A20
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A20_0123
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A20_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87447..87659
Genome map
AA seq 70 aa AA seqDB search
MVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAANALMTGSGPTVFAL
CQTEKQTIIV
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggcgattgaagcgggtaactataatgatgggatattgactgaaatgaacaat
ttgctggaagatattttcattgccaagcgaccctttattcaaaaaataaaagagaaaaca
ctgcaagctggtgctgctaatgctttgatgacaggaagtggaccgactgtttttgctttg
tgccaaaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system