KEGG   Streptococcus pyogenes A20: A20_0763Help
Entry
A20_0763          CDS       T02335                                 

Gene name
gst
Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
spya  Streptococcus pyogenes A20
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A20_0763 (gst)
Enzymes [BR:spya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A20_0763 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721947..722366
Genome map
AA seq 139 aa AA seqDB search
MPFIAKQTLKSQLIPQDNLLAESRFNEIMDFLTGDFPLVFRPMINPHRYTISQDNQALEK
VKQASYKRMDIAMTHLDSLIGESGHVYRDQQTIADAYAYAMALWSQKTPKSYENYPHLAA
FMAKMVEDSAVQQVLNAAH
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
ttgccctttatagcgaaacaaaccctgaaatctcagctcattccccaagataatcttttg
gcagaaagtcggttcaacgaaatcatggacttcttaacaggtgattttccccttgttttt
aggccaatgatcaaccctcatcgctacactatttctcaagacaatcaagcgcttgaaaaa
gtcaaacaagcttcttacaagcggatggatattgctatgacgcatttagatagtcttatt
ggggagagtgggcatgtttatcgagatcaacaaaccattgcagatgcttatgcttacgcc
atggcgctatggtctcaaaaaacaccaaaatcttacgagaattatccgcatctggcagct
tttatggcaaaaatggtggaagattcagctgttcaacaagtgcttaatgcagctcactaa

DBGET integrated database retrieval system