KEGG   Streptococcus pyogenes A20: A20_1023cHelp
Entry
A20_1023c         CDS       T02335                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spya  Streptococcus pyogenes A20
Pathway
spya00010  Glycolysis / Gluconeogenesis
spya00030  Pentose phosphate pathway
spya00051  Fructose and mannose metabolism
spya00052  Galactose metabolism
spya00680  Methane metabolism
spya01100  Metabolic pathways
spya01110  Biosynthesis of secondary metabolites
spya01120  Microbial metabolism in diverse environments
spya01130  Biosynthesis of antibiotics
spya01200  Carbon metabolism
spya01230  Biosynthesis of amino acids
spya03018  RNA degradation
Module
spya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A20_1023c (pfkA)
   00030 Pentose phosphate pathway
    A20_1023c (pfkA)
   00051 Fructose and mannose metabolism
    A20_1023c (pfkA)
   00052 Galactose metabolism
    A20_1023c (pfkA)
  Energy metabolism
   00680 Methane metabolism
    A20_1023c (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    A20_1023c (pfkA)
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A20_1023c (pfkA)
Protein phosphatases and associated proteins [BR:spya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A20_1023c (pfkA)
Messenger RNA biogenesis [BR:spya03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A20_1023c (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFV38105
Position
complement(975041..976054)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKDGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggcgacgctcctggtatgaacgctgctatt
cgtgcagtcgttcgtaaagcaatttcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgaaggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagcggtgaagcttttgctcaaaaactgaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagatggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system