KEGG   Streptococcus pyogenes A20: A20_1291cHelp
Entry
A20_1291c         CDS       T02335                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spya  Streptococcus pyogenes A20
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A20_1291c (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A20_1291c (glcK)
   00052 Galactose metabolism
    A20_1291c (glcK)
   00500 Starch and sucrose metabolism
    A20_1291c (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    A20_1291c (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A20_1291c (glcK)
   00524 Butirosin and neomycin biosynthesis
    A20_1291c (glcK)
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A20_1291c (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1213002..1213973)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgactttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcctacgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacattttcatggcggctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagaacttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system