KEGG   Streptococcus pyogenes A20: A20_1291cHelp
Entry
A20_1291c         CDS       T02335                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spya  Streptococcus pyogenes A20
Pathway
spya00010  Glycolysis / Gluconeogenesis
spya00052  Galactose metabolism
spya00500  Starch and sucrose metabolism
spya00520  Amino sugar and nucleotide sugar metabolism
spya00521  Streptomycin biosynthesis
spya01100  Metabolic pathways
spya01110  Biosynthesis of secondary metabolites
spya01120  Microbial metabolism in diverse environments
spya01130  Biosynthesis of antibiotics
spya01200  Carbon metabolism
Module
spya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spya_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A20_1291c (glcK)
   00052 Galactose metabolism
    A20_1291c (glcK)
   00500 Starch and sucrose metabolism
    A20_1291c (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    A20_1291c (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A20_1291c (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A20_1291c (glcK)
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A20_1291c (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFV38373
Position
complement(1213002..1213973)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgactttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcctacgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacattttcatggcggctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagaacttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system