KEGG   Streptococcus pyogenes A20: A20_1614Help
Entry
A20_1614          CDS       T02335                                 

Gene name
recD
Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spya  Streptococcus pyogenes A20
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A20_1614 (recD)
Enzymes [BR:spya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A20_1614 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524141..1526594
Genome map
AA seq 817 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFALQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESINRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIANNIS
RLLDTPLSQSFSHDTIQTTIQAVQKDFAITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILAADFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQPNQELKSKEQTSLFSNTATLEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaaaattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagcgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcgctatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggcctatctaaggctaatcgtcaagcctttgtc
gctaaactaaaattgaattacggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcccttcaagcgtttgaaaagtataaagaagaggctcttgacctt
gttaaagaaaatccctatcagttagtcgaagatctacaaggttttgggtttaaaatggca
gatgctctcgctgaaaacttagggattgaaagcgactctccgaaacgttttcgtgcagcc
ctccttcactgtctcttggaagaatccatcaatcgaggagatacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgatcct
gctgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctaacaacatctct
cgtctcttagatactcctttaagtcagtcatttagtcatgataccattcaaacaaccatc
caagccgttcaaaaagactttgccatcacctatgaccaagtgcagcaagaagccattact
aaggctttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaatggcgacaacgattac
caagccatggaggattatctagactgcgacctgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagctattaactcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagca
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatacaccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccctggcctat
gccatgagcattcataaatcgcaagggagtgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcagacctcccttttttctaatacggcaacc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagaatcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system