KEGG   Streptococcus pyogenes HSC5: L897_08730Help
Entry
L897_08730        CDS       T02743                                 

Definition
penicillin-binding protein 2A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
spyh  Streptococcus pyogenes HSC5
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spyh00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L897_08730
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    L897_08730
Enzymes [BR:spyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     L897_08730
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     L897_08730
Glycosyltransferases [BR:spyh01003]
 Polysaccharide
  Bacterial polysaccharide
   L897_08730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1695458..1697794)
Genome map
AA seq 778 aa AA seqDB search
MRFLELLQKKFFPKAYQEKQFLMHQKARLTPQHNQKQYSPNAHHLDSSATKNSEQDPAIA
LQRSRAYEGSPKSRPAWLQKLEAVLPSPQHPIRRFWRRYHIGKLLMILIGTLVLLLGSYL
FYLSKTAKVSDLQDALKATTVIYDHKGEYAGSLSGQKGSYVELNAISDDLENAVIATEDR
TFYSNSGINLKRFLLAVVTAGRFGGGSTITQQLAKNAYLSQDQTIKRKAREFFLALELTK
KYSKKDILTMYLNNSYFGNGVWGVEDASQKYFGTTAANLTLDEAATLAGMLKGPEIYNPY
HSLKNATHRRDTVLGAMVDAKKITQTKAQQARAVGLKNRLADTYVGKTDDYKYPSYFDAV
ISEAIATYGLSEKDIVNNGYKVYTELDQNYQTGMQTTFNNDELFPVSAYDGSSAQAASVA
LDPKTGGVRGLIGRVNSSENPTFRSFNYATQAKRSPASTIKPLVVYAPAVASGWSIEKEL
PNTVQDFDGYQPHNYGNYESEDVPMYQALANSYNIPAVSTLNDIGIDKAFTYGKTFGLDM
SSAKKELGVALGGSVTTNPLEMAQAYAAFANNGVIHPAHLINRIENARGEVLKTFTDKAK
RVVSQSVADKMTAMMLGTFSNGTAVNANVYGYTLAGKTGTTETNFNPDLAGDQWVIGYTP
DVVISQWVGFNQTDENHYLTDSSAGTASAIFSTQASYILPYTKGSQFHVDNAYAQNGISA
VYGVNETGNQSGVDTQSIIDGLRKSAQEASQSLSKAVDQSGLRDKAQSIWKEIVDYFR
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgagatttctagaacttttacaaaagaaattttttcctaaagcatatcaggaaaaacaa
ttcttaatgcatcaaaaagcgcgtttaacgccacaacacaatcaaaagcagtattcgcca
aatgcccatcatttggactcatcagctaccaaaaactcagaacaagaccctgcaatagct
ctgcaacgcagtagagcctatgaaggaagccctaaaagtcggcccgcttggttgcaaaag
ctggaagctgttttgccgtctcctcaacatccaattcggcgtttttggcgccgctatcac
atcggaaaactgctaatgattctgattggaactcttgtcttactcttaggatcatacttg
ttttacttatcaaaaacagctaaagtatctgatttacaagatgccttgaaggctacaact
gttatttatgatcacaaaggagagtatgcaggcagtttatctggtcaaaaagggagttat
gttgagctcaacgctatttcagatgatcttgagaatgctgttattgccactgaggatagg
actttttacagtaatagcggtattaatcttaaacgcttcttattggcggtagttacggcg
ggccgctttggaggtggctcaacgattacacagcaactggctaaaaatgcttatctctca
caagatcagacaattaaacgaaaggccagagagttttttttggcgttagagttgaccaaa
aaatacagtaaaaaagatattcttactatgtaccttaacaactcctattttggaaatgga
gtttggggagttgaagatgccagtcaaaaatattttggaaccacagctgctaacttaaca
ttggatgaagctgccacattagcaggtatgctcaaaggacctgaaatatataacccttac
cattctctaaaaaatgctactcaccgtagagatactgttttaggagcgatggttgatgcc
aaaaagattacccaaacaaaagctcagcaagctagagcagtagggctaaaaaatcgctta
gctgatacttatgttggtaagacagatgactacaaatacccatcctactttgatgctgtt
attagtgaagcaatagcaacttatggtctttcagaaaaagacattgttaataatggatac
aaagtttacaccgagctagatcaaaattaccaaactggcatgcagacgacttttaacaac
gatgaactatttcctgtttcagcttatgacggtagctctgctcaagcagctagtgttgct
ttagatcctaaaacaggaggtgttagaggtctgattggtcgtgtgaatagtagtgaaaat
ccgactttcagaagttttaactatgcgactcaagcaaaacgtagtcccgcatcaacaatc
aaaccactcgtggtttacgcgccagccgttgcttcaggatggtcaattgaaaaagaacta
ccaaataccgttcaagatttcgatggctatcagccacataattatggaaattatgaatca
gaagatgttcctatgtatcaagcattagcaaactcttataatattccagcagtttctaca
ttgaacgatatcggaatcgataaagcctttacctatggtaaaacatttgggttagatatg
agctctgccaaaaaagagttgggggtagctttaggtggcagcgtgacaaccaatccattg
gagatggctcaggcatatgctgcctttgccaataatggagtaatccatcctgcgcacttg
attaaccggattgaaaatgccaggggtgaagtgcttaaaacctttactgataaggctaaa
cgtgttgtcagccagtctgttgcagataagatgacagccatgatgctaggtaccttttca
aatggaacagcagtcaatgctaacgtatatggctatacactagctggtaaaacagggacg
acagaaaccaacttcaatcccgacttagcaggcgatcagtgggttattggttatacgcca
gatgttgttattagtcaatgggtaggatttaatcagaccgatgaaaatcattatctaacg
gattcaagtgcaggcacggcctcagctatttttagcactcaggcatcttacattttgcct
tataccaagggcagccaatttcatgtagataatgcctacgctcaaaatggtatttcagct
gtttatggagtcaatgaaacaggtaatcaatcaggagttgatactcaatctattattgat
ggtttaagaaaatcagcacaagaagcttcgcaatcactatcaaaagcagtcgatcagtca
gggttacgtgataaagcccaatctatttggaaagagattgttgactattttagatag

DBGET integrated database retrieval system