KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0489Help
Entry
M1GAS476_0489     CDS       T02499                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M1GAS476_0489
   00630 Glyoxylate and dicarboxylate metabolism
    M1GAS476_0489
   00640 Propanoate metabolism
    M1GAS476_0489
   00650 Butanoate metabolism
    M1GAS476_0489
  Lipid metabolism
   00071 Fatty acid degradation
    M1GAS476_0489
   00072 Synthesis and degradation of ketone bodies
    M1GAS476_0489
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M1GAS476_0489
   00310 Lysine degradation
    M1GAS476_0489
   00380 Tryptophan metabolism
    M1GAS476_0489
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M1GAS476_0489
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M1GAS476_0489
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M1GAS476_0489
Enzymes [BR:spym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M1GAS476_0489
Exosome [BR:spym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M1GAS476_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:443483..444631
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLSGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaacgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgtcaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaaggtcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system