KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0800Help
Entry
M1GAS476_0800     CDS       T02499                                 

Gene name
cpsFP
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M1GAS476_0800 (cpsFP)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M1GAS476_0800 (cpsFP)
Enzymes [BR:spym01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     M1GAS476_0800 (cpsFP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756464..757057
Genome map
AA seq 197 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKL
QNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMF
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEAD
KNHPLLSDVKPLKPKDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaaaagaaaaaatgttgccaattggctttccagaacgtttttttgaggaaggaaaacta
caaaacaacgtttctttttcacgtcagcatgtgctgcgtggacttcatgctgaaccttgg
gataaatacatctcagttgctgatgatggcaaggttttaggagcttgggttgatcttcgt
gagggagagacttttggaaacgtctaccagacagtgattgatgcttcaaaaggaatgttt
gttcctagaggggttgctaatggctttcaagttctttcagagactgtctcttacagttat
cttgtcaatgactactgggctcttgacttgaaacctaagtatgcttttgtaaactatgct
gacccaagtcttgggattacttgggaaaatctagcagctgcagaagtttctgaagcagat
aaaaaccatcctcttcttagtgatgtcaaaccactgaaaccaaaagacctatag

DBGET integrated database retrieval system