KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0877Help
Entry
M1GAS476_0877     CDS       T02499                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00790  Folate biosynthesis
spym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M1GAS476_0877 (folE)
Enzymes [BR:spym01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     M1GAS476_0877 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: BAM30207
UniProt: J7MA14
Position
1:835173..835775
Genome map
AA seq 200 aa AA seqDB search
MKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGK
DPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARA
VEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTAR
GLYKESRAERQEVISLMTKD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaaaaagca
gaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaaggtctt
cttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactgggaaaa
gatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtgattgtc
aaagacattagtttttattctatatgtgaacaccacttagttcctttttatggcaaggct
catatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcgcgagca
gttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaatagcggat
gctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagagcacatg
tgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccactgccaga
ggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgacaaaagat
tag

DBGET integrated database retrieval system