KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0919Help
Entry
M1GAS476_0919     CDS       T02499                                 

Gene name
tdk2
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spym00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871344..871913
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacacgtgatggttttggcatcgtctcaagccgtattggtatgcgacgagaagctatc
cccatttcaaatgacatggatattttcacatttattgcccaattggaggaaaaaccttat
tgtgtcctgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggatgagctaaatgttcctgtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system