KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_1449Help
Entry
M1GAS476_1449     CDS       T02499                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M1GAS476_1449
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M1GAS476_1449
Enzymes [BR:spym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M1GAS476_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359961..1360788)
Genome map
AA seq 275 aa AA seqDB search
MGMMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAM
GFGLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAYYQTNVSQILLTRDVVVFPES
LANVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLS
DIDGLFDKNPTIYEDAQLRSHVANITQEIIASAGGAGSKFGTGGMLSKVQSAQMVFENKG
QMVLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcact
agttcattagtgctaccaacaggtaaaattaatttagaaaaaatcgaccaactggctttt
gtgatttcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatg
ggatttggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacag
gcagtttccagtgttggtcaggtagccatgatgagtctttattcacaaatttttgcatac
taccaaaccaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagt
ctagccaatgttaccaatgcttttgaaagtctgattagtttgggcattgtgccgattgtt
aatgaaaacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataat
gaccgtttatctgctgttgttgctggtattacaaaagctgatttattaatcatgttgtct
gatattgatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagc
catgttgctaatattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaagttt
ggcacaggtgggatgctaagtaaggtgcagtctgctcagatggtatttgaaaacaaagga
cagatggtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaa
ccactaggcacctggttcaagcagatagaagaggtaaggcatgactga

DBGET integrated database retrieval system