KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_1449Help
Entry
M1GAS476_1449     CDS       T02499                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00330  Arginine and proline metabolism
spym00332  Carbapenem biosynthesis
spym01100  Metabolic pathways
spym01130  Biosynthesis of antibiotics
spym01230  Biosynthesis of amino acids
Module
spym_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M1GAS476_1449
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    M1GAS476_1449
Enzymes [BR:spym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M1GAS476_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: BAM30767
UniProt: J7MAV3
Position
1:complement(1359961..1360788)
Genome map
AA seq 275 aa AA seqDB search
MGMMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAM
GFGLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAYYQTNVSQILLTRDVVVFPES
LANVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLS
DIDGLFDKNPTIYEDAQLRSHVANITQEIIASAGGAGSKFGTGGMLSKVQSAQMVFENKG
QMVLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcact
agttcattagtgctaccaacaggtaaaattaatttagaaaaaatcgaccaactggctttt
gtgatttcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatg
ggatttggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacag
gcagtttccagtgttggtcaggtagccatgatgagtctttattcacaaatttttgcatac
taccaaaccaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagt
ctagccaatgttaccaatgcttttgaaagtctgattagtttgggcattgtgccgattgtt
aatgaaaacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataat
gaccgtttatctgctgttgttgctggtattacaaaagctgatttattaatcatgttgtct
gatattgatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagc
catgttgctaatattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaagttt
ggcacaggtgggatgctaagtaaggtgcagtctgctcagatggtatttgaaaacaaagga
cagatggtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaa
ccactaggcacctggttcaagcagatagaagaggtaaggcatgactga

DBGET integrated database retrieval system