KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_1591Help
Entry
M1GAS476_1591     CDS       T02499                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spym00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    M1GAS476_1591
   01230 Biosynthesis of amino acids
    M1GAS476_1591
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M1GAS476_1591
   00290 Valine, leucine and isoleucine biosynthesis
    M1GAS476_1591
Enzymes [BR:spym01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M1GAS476_1591
    2.6.1.66  valine---pyruvate transaminase
     M1GAS476_1591
Amino acid related enzymes [BR:spym01007]
 Aminotransferase (transaminase)
  Class I
   M1GAS476_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484593..1485843)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SISLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgagggcctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcttttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcgcgtaaggctatcatgcagtattgccaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatatcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgt
gatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagccctttatcctaaggag
attttagaagacatcgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatggtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggtctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggtta
aacatgcttgccaatatgcggttatgctccaatgttttagcccaacaagttgttcaaact
tccttaggaggtcatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaagcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgtccaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system