KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_0074Help
Entry
M5005_Spy_0074    CDS       T00262                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spz00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87087..87224
Genome map
AA seq 45 aa AA seqDB search
MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQMAPYS
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgatttcaagttaaaagaggagtttccgtttacttggaaaagcggattccc
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
atggctccttactcttag

DBGET integrated database retrieval system