KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_0076Help
Entry
M5005_Spy_0076    CDS       T00262                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M5005_Spy_0076
Enzymes [BR:spz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M5005_Spy_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87499..87660
Genome map
AA seq 53 aa AA seqDB search
MNNLLEDIFIAKRPFIQKIKEKTLQAGAANALMTGSGPTVFALCQTEKQTIIV
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttgctggaagatattttcattgccaagcgaccctttattcaaaaaataaaa
gagaaaacactgcaagctggtgctgctaatgctttgatgacaggaagtggaccgactgtt
tttgctttgtgccaaaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system