KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_0192Help
Entry
M5005_Spy_0192    CDS       T00262                                 

Gene name
hasC.2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M5005_Spy_0192 (hasC.2)
   00052 Galactose metabolism
    M5005_Spy_0192 (hasC.2)
   00500 Starch and sucrose metabolism
    M5005_Spy_0192 (hasC.2)
   00520 Amino sugar and nucleotide sugar metabolism
    M5005_Spy_0192 (hasC.2)
Enzymes [BR:spz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M5005_Spy_0192 (hasC.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(198276..199175)
Genome map
AA seq 299 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKS
KRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTFV
GNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQA
KAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDT
LNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgttttttacct
gcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaattt
atcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaatcc
aaacgctccatagaagatcattttgattctaattttgaattagaatataatttacaggct
aaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatcttcacttt
attcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacctttgtt
ggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaatccaaat
gtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaactatt
gccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcctcaagca
aaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaagat
gcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagtatt
ttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgatacc
ctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgttggc
gataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtcaaa
gatgacttgaaagcctacatcatccaactgggcaaagcactagagaagacaaaaccataa

DBGET integrated database retrieval system