KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_0821Help
Entry
M5005_Spy_0821    CDS       T00262                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816434..817000
Genome map
AA seq 188 aa AA seqDB search
MSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFKE
QHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQE
RLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAERQE
VISLMTKD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaataaggaaaaagcagaagcagccatttatcagtttttagaggctattggt
gaaaatccaaatcgggaaggtcttcttgacacgcctaaacgggttgctaaaatgtatgcg
gagatgtttttgggactgggaaaagatcctaaagaggagtttacggctgtctttaaagaa
caacatgaggatgtggtgattgtcaaagacattagtttttattctatatgtgaacaccac
ttagttcctttttatggcaaggctcatatcgcttacttgccaagtgatggtcgagtaaca
ggtttgagtaaattagcgcgagcagttgaagtagctagtaaacgacctcaactccaagag
cgtttgacctctcaaatagcggatgctttagttgaagccctcaatcctaaagggacttta
gttatggtagaagcagagcacatgtgcatgaccatgcgaggcatcaaaaagccaggtagt
aaaaccattaccaccactgccagaggcttatataaggaaagtcgtgctgagaggcaagaa
gttatttctctaatgacaaaagattag

DBGET integrated database retrieval system