KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_1056Help
Entry
M5005_Spy_1056    CDS       T00262                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M5005_Spy_1056 (malM)
Enzymes [BR:spz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     M5005_Spy_1056 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1025206..1026699)
Genome map
AA seq 497 aa AA seqDB search
MNKRASGILMHISSLPGKFGIGTFGKSAFEFVDFLAETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFELLVDDELLEAADLCDITFGTNPEAVDYAQLFQVRRPLLEKAVRAFV
AEQENVCKLEAFETASSWLTDFAEFMALKEYFNNKALQDWDDETVIKRQEDSLNNYRELL
AKKITYHKVCQYFFYQQWSALKTYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
KPLFIAGVPADGFSEDGQLWGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGF
SDFWEIPAGDKTARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEEQVHFVNNYLH
KHADESITKAMLRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQ
DHKDYLIYLTDLYGRAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgcaagcggtatcttaatgcatattagttccctgcctgggaaatttggg
ataggcacttttggaaaatcagcttttgaatttgttgattttctagcagagacgaaacaa
acctattggcaaattctgcctttaacaacgacgagttttggagattctccttatcagtca
ttttcagctattgctgggaacacacatttcattgattttgaattgctagtagatgatgaa
cttttagaagcagcagatttgtgtgatattacattcggcacaaatcctgaagcagtagac
tatgctcagctttttcaagttagacgtccacttttagaaaaagcagtgagagcttttgtt
gctgaacaagaaaatgtgtgtaaattagaagcttttgaaacagcttctagctggttaact
gattttgctgaatttatggctttaaaagaatattttaacaataaagccttacaagattgg
gacgacgaaactgtcattaaacgccaagaagactcacttaataattaccgtgagttactt
gcaaaaaagattacctatcataaagtctgtcaatacttcttttaccaacaatggtcagcc
ttgaaaacttacgctaaccataaagggatagaaattattggtgatatgcctatttatgtt
tctgcggacagtgtagaagtttggacgatgcctgagctatttaaagtagatagtgataaa
aagccattgtttattgcaggtgtaccagcagatggctttagtgaagatggtcagctgtgg
ggaaatccaacctacaattggtctgctcatgaaaagtctaattttgcatggtggatttat
cgtattcaagaaagtttcaaactatatgatcagctaagaatcgatcattttaaaggcttc
tcagatttttgggaaattcctgctggtgataaaactgctagaaatggccattgggcctca
gccccaggtatagcattattttctgcggttcgtgaggccttaggagagctccctatcatc
gcagaaaacctgggttatattgatgaaaaagcagagcagctattagcatcaacaggcttt
cctggcatgaagatattagaatttggtttatttgatataacgagtcaaagtatagattta
ccacattactatgaccgtaattgtgtcgcttacacagggactcatgataacgaggtggtt
aacggatggtatgacaatcttagtgaagaacaagtacactttgtaaataactatcttcac
aaacatgcagatgaaagtattacaaaagccatgctaagaacaatctttgcttctgtttgt
gatacagccattctttgcatccaagatttattagataaagatggtaagagtcgtatgaat
atgccaaatacaattggaggtaattggcaatggcgtatgcttgacggtgaattgaaccaa
gatcacaaagattaccttatttatttaacagatctttatggtcgcgcaagataa

DBGET integrated database retrieval system