KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_1311Help
Entry
M5005_Spy_1311    CDS       T00262                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:spz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spz00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spz00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:spz00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269478..1270356
Genome map
AA seq 292 aa AA seqDB search
MSLLCIDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQEVARYSAYHFSGIAIS
SPGAVNKEKGVIEGASAIPYIHHFKIQEALEERLHYPISIENDANCAALAEATLGAGKGA
SSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTFSQLGTVVNMAKRYSA
IVNNGKDYTGKAVLALAEQGDPLALKERQVFLQSLAIGIFNIQHAFDPQLILIGGGVSQA
DFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDFYQEHKEA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgttatgtattgatataggaggcacttcccttaaatttgccctctgtcacaat
ggccaattaagccagcaaagcagctttcccactccctctagtctggaaaagttttaccaa
ttactcgaccaagaagttgctcgttactctgcttaccatttctcaggtattgccatcagt
tcacctggggcagtcaataaagaaaagggggttatcgaaggcgccagcgctattccctac
attcaccattttaaaatacaagaggccttagaagaacggctacattaccctatttctatc
gaaaatgatgccaattgtgccgccttagctgaagctaccttaggggcaggaaaaggcgct
agtagcctagccatgctcgttcttggtactggagttggaggaagcttggtcattgatggc
aagatttaccatggtgcccacttatttgggggcgagtttggtttcatgatcatgaacgac
cgctaccaaacctttagtcagttagggacagtggtaaatatggccaagcgctatagtgca
atcgtcaataacggaaaagattatactggcaaagctgtccttgccctcgcagaacaagga
gatcccctagcactcaaagaaaggcaggtctttctccaaagtttagccatcggtattttt
aacattcaacacgcctttgatcctcaactgattttaatcgggggtggtgtttcccaagct
gactttctactgtcagcgattgaagctgaactagacaaactctaccaagccgtcgaaatc
tccgaccttagaccccaattagctatttgtcactttaaaaacgaagctaatcttctggga
gctgccattgatttttaccaagaacacaaggaggcctaa

DBGET integrated database retrieval system