KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_1347Help
Entry
M5005_Spy_1347    CDS       T00262                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:spz00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:spz00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314558..1315337
Genome map
AA seq 259 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETLLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYNSAKHGLIGLTKVTALEAADSGITVN
AICPGYVDTPLVRGQFEDLSKTRGIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASD
KAKGVTGQACILDGGYTAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaattggaaaacaa
atcggggaaaccttattaaaagaaggtaaaacggttgttttttccgacattaatcaagaa
aaactggatcaggttgttgctgactatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggtcttcaacatgttgccatgattgaagat
tttccaactgaaaaatttgaattcatgattaaaatcatgttgacagcaccatttattgcc
attaaacgtgcttttcctacaatgaaagctcaaaaacacggtcgtattattaatatggct
tctatcaatggtgtcattggttttgctggcaaatccgcctacaattcagctaagcacggc
ttgatcggtctgaccaaagtaactgccttagaagctgctgattcaggcattacggtcaat
gccatttgtcctggatatgttgacacaccactggttcgtggccagtttgaagacctttcc
aaaacaagaggtattccccttgaaaatgttcttgaagaagtgctatacccacttgttcct
caaaaacgcctcattgacgttcaagaaattgcagactatgtgtctttccttgccagtgat
aaggcaaaaggtgttacaggtcaagcctgtatcttagacggtggctacactgctcaataa

DBGET integrated database retrieval system