KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy_1503Help
Entry
M5005_Spy_1503    CDS       T00262                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M5005_Spy_1503
   01230 Biosynthesis of amino acids
    M5005_Spy_1503
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5005_Spy_1503
  Energy metabolism
   00680 Methane metabolism
    M5005_Spy_1503
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M5005_Spy_1503
Enzymes [BR:spz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     M5005_Spy_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1458167..1458874)
Genome map
AA seq 235 aa AA seqDB search
MTKTRLYIARHGKTMFNTIGRAQGWSDTPLTKKGEEGIRELGLGLKDATIPFKAAFSSDS
GRTMQTIEIILRESENEFLPYTKDNRIREWCFGSLEGTYDSELFLGVLPRTKAFENRDNL
RDVPYSELAESIVEVDTANWAEPWEVLRKRIWEGFEAIALSIQNAGGGNALVVSHGMTIG
TFLWLIDLDRDKQYIDNGSVTVVEFDDGQFTIKTIGDMSYRYRGREIIEERSDEI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaaggttgtatattgccagacatggaaaaacgatgtttaataccattggt
cgcgctcagggttggagtgacacacctcttacaaaaaaaggagaagaaggtattcgagaa
cttggcctaggtttaaaagatgcaactataccatttaaggctgcgttttcaagtgattca
ggtcgaaccatgcagacaatagaaattattttaagagaatcagaaaacgaatttttgcct
tatactaaagataatcgtattcgtgagtggtgttttgggagtctagaagggacttatgat
tcagaattatttctaggtgtccttccaagaacaaaagcctttgaaaatcgtgataaccta
cgtgatgttccctattctgaactggcagaaagcatcgtggaagtagataccgctaattgg
gcagaaccatgggaagttcttcgtaagcgcatttgggaggggtttgaagctattgccttg
tctattcaaaatgctggcggcggaaatgctcttgtggttagccatggtatgacaattgga
acgtttctgtggttgattgatctagatcgagacaaacagtatattgataatgggagcgtt
acagttgttgaatttgatgatggccaatttacgataaagactattggagatatgagttac
cgctaccgcggtcgtgaaataatagaagaacggtcagatgaaatataa

DBGET integrated database retrieval system