KEGG   Serratia sp. AS13: SerAS13_0058Help
Entry
SerAS13_0058      CDS       T02012                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sra  Serratia sp. AS13
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sra00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sra00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(64979..66298)
Genome map
AA seq 439 aa AA seqDB search
MQSYFDQLEQVRYEGPDSNNPLAFRHYNPDEWVLGKRMADHLRFAACYWHTFCWNGADMF
GVGAFDRPWQQPGDALALAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
VMTDVLAEKQQSSGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENALVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAAKMTADDRLPQQVARRYAGWNGELGQQILQGKLSLEALAQYAEQHALAPQ
HASGRQEQLENLMNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcctattttgatcagcttgagcaagttcgctacgaaggccccgacagcaataac
ccgctggctttccgccactataatcccgatgagtgggtactcggcaaacgtatggccgat
cacctgcgcttcgccgcctgttactggcacaccttctgctggaacggcgcggacatgttc
ggcgtcggagcctttgatcgcccctggcagcagccgggcgatgcgctggcgctggcaaaa
cgcaaggccgacgtggcgttcgaattcttccacaagctgaacgtgccttactattgcttc
cacgacgtcgacgtttcgccggaaggcgcttcgttgaaagagtatctgaataactttgcg
gtaatgaccgacgtgctggcggaaaagcagcaaagcagcggcgtgaagctgttgtggggc
accgccaactgctttacccatccgcgctacggcgcaggcgcggccaccaacccggatccg
gaagtgttcagttgggcggccactcaggtattcaccgccatgaacgccacccatcaactg
ggcggcgagaactacgtgctgtggggcgggcgcgaaggttacgaaaccctgctgaatacc
gatctgcgccaggagcgcgagcagattggtcgctttatgcaaatggtggtggagcacaaa
cacaaaaccggcttccagggcacgctgctgatcgaacccaaaccgcaggaacccaccaag
caccagtacgactacgatgtcgccacggtgtacggcttcctgaagcagttcgggctggag
aaggagatcaaggtcaatatcgaggccaaccacgccaccctggccgggcactccttccac
catgaaatcgccaccgccatcgcgctcggcatcttcggctcggtcgacgccaaccgcggc
gatccgcagctgggctgggataccgaccagttccccaacagcgtggaggagaacgccctg
gtgatgttcgaaatcctcaaggccggcggtttcaccaccggtggcctgaacttcgacgcc
aaggtccgccgccaaagcaccgacaaatacgatctgttctacggccatatcggtgcgatg
gacacgatggcgctggcgctgaaagtggcggccaaaatgaccgccgacgaccggcttcct
cagcaggtcgcccgacgttacgccggctggaacggtgagctgggccagcaaattttgcag
ggcaaactgtcgctggaagccctggcgcagtacgctgaacaacatgcactggcgccgcag
cacgccagcggccgtcaggaacagctcgagaacctgatgaaccgctacctgttcggttaa

DBGET integrated database retrieval system