KEGG   Serratia sp. AS13: SerAS13_0111Help
Entry
SerAS13_0111      CDS       T02012                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sra  Serratia sp. AS13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SerAS13_0111
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SerAS13_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
126701..127813
Genome map
AA seq 370 aa AA seqDB search
MFATLKRLTFGMLLLCAFSAAAACEWPAWQQYKQFYISEEGRVIDPSSPNRITTSEGQSY
GLFFALVANDRPTFDKLLEWTENNLAAGDLSAHLPAWLWGEDDKKRWTVLDTNTASDADL
WIAYNLLEASRLWKSRRYQTLGTLLLQRIGREEVADIPGLGLMLLPGKVGFVAEDRWRLN
PSYLPPQLLARFAALNGPWRAMQQTNQRLLLETAPHGFSPDWAVWQAGKGWQADTVKPDV
GSYDAIRVYLWAGMLADDDEHKAALIKQLLPMAQLTAQQGVPPEKADTASGKTSGDGPVG
FSAAMLPMLANQTAALDAQRQRINQHPPGDDAYFSASLTLFGQGWDQQRYRFNRQGELQP
AWGGQCVTSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcaacgctgaaacgcctgacgttcggcatgctgctgctgtgcgcattcagcgcg
gcggcggcctgcgagtggccggcctggcaacagtacaaacagttttacatcagcgaggaa
ggacgggtgatcgaccccagcagcccgaaccgcatcaccacctcggaagggcagagctac
ggcctgtttttcgctctggtggcgaacgatcggccgacgttcgacaagctgctggaatgg
acggaaaacaacctggcggcgggcgatctcagcgcccatttacccgcctggctgtggggc
gaggacgataaaaagcgctggacggtgctggacacgaatacggcgtccgatgccgatctg
tggattgcctacaatctgctggaagccagtcgtttgtggaaaagcaggcgttatcaaact
ctgggtacgctgctattgcagcgtatcggtcgcgaagaagtggccgatattcccggactg
gggctgatgctgctgccgggcaaggtcgggttcgtggcggaagatcgctggcggctcaat
ccgagctacctgccgccgcagctgctggcgcgtttcgccgcattgaacggcccatggcga
gcgatgcagcaaaccaatcagcggctgttgctggaaaccgcgccgcacggcttttcgccg
gattgggcggtgtggcaggccggcaaaggctggcaagcggataccgtgaaaccggatgtc
ggcagttacgacgccatccgggtttatctgtgggccggcatgctggcggatgatgacgag
cataaagccgcattgatcaaacagctgctgccgatggcgcaattgaccgctcaacagggc
gttccgccggaaaaagccgacaccgccagcggtaaaaccagcggcgatggcccggtgggc
ttctccgccgccatgctgccgatgttggccaaccaaacggctgcgctggacgcccagcgt
caacgcatcaatcaacaccctccgggcgacgatgcctatttcagcgcctctttgacgctg
ttcggccagggatgggatcaacaacgttatcgttttaatcggcagggtgaacttcaaccc
gcctggggcggccaatgcgtaacttcaaaataa

DBGET integrated database retrieval system