KEGG   Serratia sp. AS13: SerAS13_0156Help
Entry
SerAS13_0156      CDS       T02012                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sra  Serratia sp. AS13
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sra00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
182972..184009
Genome map
AA seq 345 aa AA seqDB search
MTSFTQGTDDWLMRETQFAAFATGPLLDFWRLREEGEFSGVGGVPIRFVRFSSARHQRVV
VISPGRIESYVKYPEVAYDLFHCGFDVMIIDHRGQGRSGRLLADTHRGHVVNFADYIDDF
AQFYRQQVAPRGYRQHFALSHSMGGAILAQFLARQPQAFDAAAFCAPMFGIHLPMPGWMA
DRILNWVEKHPAVRNYYAIGTGQWRPLPYVVNVLTHSRERYRRCLRYYADYPELQVGGPT
YHWVRESIQAGRQIVAQAAKITTPLLLLQAGEERVVDNRSQQAFCQALSDAGHPCEGGKP
RVIQGARHEILFERDAMRAEALNAILRFFAQHLGGAPAADHSIRG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgttcactcaaggcaccgatgactggttaatgcgtgaaacgcagttcgctgct
ttcgctaccggcccgctgctggacttttggcggttgcgggaggagggcgagttcagtggc
gtgggcggcgtgccgatccgcttcgtgcgtttcagctctgcacgtcaccagcgggtggtg
gtgatcagccccggccgtatcgaaagttacgttaaatatccagaagttgcctacgatctg
ttccattgcggttttgatgtgatgattatcgatcatcgcgggcaaggccgttctggccgc
ttgctggctgatacgcaccgcggtcatgtggtaaactttgccgattatattgacgatttc
gcccagttttatcggcagcaagtggcgccgcgcggctaccggcagcactttgcgctgtcg
cattcgatgggcggcgcgatactggcgcagtttctggcgcgtcagccgcaggcgtttgat
gccgctgcgttttgcgcgccgatgttcggcattcatctgccgatgccgggctggatggcg
gaccgcatccttaactgggtggagaaacacccggcggtgcgcaattactatgcgataggc
accggccagtggaggccgctgccctatgtggtcaacgtattgacccacagccgtgaacgc
tatcgccgctgtttgcgttattacgccgattatcccgagttgcaggtgggtggccctacc
taccactgggtaagagaaagcattcaggccgggcggcagattgtcgcgcaggcggctaaa
atcaccacaccgctgttattattgcaggccggtgaggaacgggtggtcgacaaccgttct
cagcaggctttttgtcaggcactgtcagacgcggggcacccttgcgaaggggggaaaccg
cgggttatccaaggcgcacgccatgagatcctgttcgagcgggacgcgatgcgcgccgaa
gcattgaacgcaatcctgcgtttctttgctcaacacttaggtggcgcccctgccgccgac
cactccatcagaggttag

DBGET integrated database retrieval system