KEGG   Serratia sp. AS13: SerAS13_0210Help
Entry
SerAS13_0210      CDS       T02012                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sra  Serratia sp. AS13
Pathway
sra00860  Porphyrin and chlorophyll metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
Module
sra_M00121  Heme biosynthesis, glutamate => heme
sra_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SerAS13_0210
Enzymes [BR:sra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SerAS13_0210
Exosome [BR:sra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SerAS13_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEG26033
Position
238395..239417
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGVFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGSNRQEAVASMPGVS
RMSIDLLIKEAEAIAKLGVPVISLFPVIEPSLKSLHAEEAYNPDGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDEHGYVINDISKDILVRQALSHAEAGAEIVAPSDMMDGR
IGAIRDRLEHQGLVNTQIMAYSAKYASCYYGPFRDALGSSSNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEQPAVMESLMCFKRAGADGVLTYFAKRVAQWMHDEAMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcgtctttccaggccgccgtatgcgccgtgtgcgccgtcat
gatttcagccgtcgtctggtggcggagaatcaactgacggttaacgacctgatttatccg
gtatttgtcatggaaggcagtaaccgtcaggaagcggtagcatccatgccaggcgtatcg
cgcatgagtatcgatctgctgattaaggaagcggaagccatcgccaaacttggcgtgccg
gtgatctccctgttcccggtgattgaaccgagtctgaagtcattgcatgcggaagaagct
tataatccggacggtttggtgcaacgtacggtgcgtgcgttgaaagacgcggtgccagag
ttgggtattctgactgacgtggcactggatccttacaccactcacggccaggatggcgtg
attgatgagcacggctacgtcattaacgatatcagcaaagatatactggtgcgtcaggca
ttatcccatgcggaagccggagcggaaatcgtggcgccgagcgatatgatggacggccgt
atcggcgctatccgcgatcgtctggagcatcaggggctggttaatacccagatcatggcg
tactccgccaaatatgcctcctgctactatggcccgttccgcgatgcgctcggttccagc
agcaatctgaaaggcggcaataagaaaacctatcagatggaccctgccaacagtgacgaa
gcgctgcaggaaattgcgcaagatctccaggaaggcgcggatatggtgatggtgaaaccc
ggtatgccttatctggatgtggtgcgtcgggtgaaagacacctttggcgtgccgaccttt
gcctatcaggtttcaggtgaatatgcgatgcacatggcggcgattcagaacggttggttg
caggagcaaccggcggtgatggagtcgctgatgtgctttaagcgcgccggggctgatggc
gtgctgacctacttcgccaagcgggtagctcagtggatgcatgatgaagcgatgcagcgc
taa

DBGET integrated database retrieval system