KEGG   Serratia sp. AS13: SerAS13_0394Help
Entry
SerAS13_0394      CDS       T02012                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sra  Serratia sp. AS13
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SerAS13_0394
Enzymes [BR:sra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SerAS13_0394
Transfer RNA biogenesis [BR:sra03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SerAS13_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
439929..440669
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLSREAGAAIMAVYDGEQPLDVAQKKDDSPVTAADLAAHHIIKRGLAALTPDVP
LLSEEDPPTWEVRQNWTRYWLVDPLDGTKEFLNRNGEFTVNIALIEDGQAVMGVVYAPAI
DVLYLAERGKAWKEEKGQRQAISVSNAHPPLVVVSRSHSDEELKDYLNQLGEHQTISVGS
SLKFCLVAEGKAQLYPRFGPTNIWDTAAGHAVAVAAGAQIHDWKGQPLLYTPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgccaactgtcccgcgaggcgggggcggcaatcatggcggtgtat
gacggtgaacaaccgcttgatgtcgcgcagaaaaaagatgattcaccggtgacggcggcc
gatctggcggcgcatcatattatcaaacgtgggctggcggcgttaacgccggacgtgccg
ctgctgtcggaggaagatccgccgacctgggaggtgcgtcagaactggacgcgttattgg
ctggtcgatccgctggacggcaccaaggaattcctcaaccgcaacggcgagtttacggtc
aacatcgcgctgattgaagacggccaggcggtaatgggcgtggtttacgcaccggcgatc
gacgtgttgtacctggccgagcgcggtaaagcctggaaagaagagaaaggacaacgccag
gcgatcagcgtcagcaacgcccatccgccgctggtggtggtgagccgctcccacagcgat
gaagaattgaaggattacctgaaccaactgggcgagcatcagactatttctgtcggatca
tcgctgaagttctgtttggtggcggaaggaaaggcgcagctctatccgcgttttgggccg
accaatatctgggataccgccgccggccatgccgtcgcggtggctgccggggcgcagatc
cacgactggaagggccagccgttgctttatacgccgcgtgaatctttcctcaaccccggc
ttccgggtttcgctgttctga

DBGET integrated database retrieval system