KEGG   Serratia sp. AS13: SerAS13_0590Help
Entry
SerAS13_0590      CDS       T02012                                 

Definition
DNA-directed DNA polymerase (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sra  Serratia sp. AS13
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sra00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sra00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sra03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sra03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sra03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
656934..657371
Genome map
AA seq 145 aa AA seqDB search
MASKRDWLLQQLGITQWTLRRPGVLQGEVAVSLPPDVRLLVVAQPLPEHNDPLFCDVLRS
LGLTPAQTYGLTPDQVAMLPEDTECNSWRLGVAEPLAVAGAQLHSPALAELSLDASAKRA
LWQQICHHEQYFYPDGGRSGHGIQD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaacgcgactggctgttacaacaactgggtattacgcagtggacattgcgc
cgcccgggcgtgttgcagggcgaagtagcggtcagcctgccgcccgatgtgcgtttgctg
gtggtggcgcagccactgcctgagcataacgatccgctgttttgcgacgtgttgcgcagc
ctggggctgaccccggcgcaaacctatggcctgacgccggaccaggtagcgatgctgcct
gaggataccgaatgcaacagttggcggctgggcgtcgcggagccgctcgcggtggccggc
gcacaactacacagcccggcactggccgagctttccctcgacgcgagtgccaagcgcgca
ctctggcagcagatttgtcatcatgaacagtatttctaccctgacggcggccgatctggc
cacggcattcaagattga

DBGET integrated database retrieval system