KEGG   Serratia sp. AS13: SerAS13_0625Help
Entry
SerAS13_0625      CDS       T02012                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sra  Serratia sp. AS13
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SerAS13_0625
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SerAS13_0625
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SerAS13_0625
Enzymes [BR:sra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SerAS13_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
693721..695010
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDHLLEQDFVTRSTRILS
AFIGDEVSEEALHKRVAAAFEFPAPVAQVEDDIACLELFHGPTLAFKDFGGRFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDQELKEALHLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLTNGQWQPQATVATLSNA
MDVSQPNNWPRVEELFRRKIWQLKDLGHATVSDETTRDTMRELAQLGYLSEPHAAIAYRA
LRDQLREGEFGLFLGTAHPAKFKESVEEILGQELPLPKALALRADLPLLSHSLPAGFAEL
RKFLMALPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaggatcacaacgagcaggtcagcttcgcgcaggcgatcaaa
cagggcctgggcaaacagcaagggctgtttttcccgctggagctgccggagtttgaactg
accgaaatcgatcacctgctggagcaggactttgtcacccgcagcacccgtatcctgtcg
gcgtttatcggcgatgaagtgtcggaagaggcgctgcataagcgcgtggcggcggcgttt
gaattccctgcgccggttgcgcaagtagaagacgacattgcctgtctggagctgttccac
ggcccgacgctggcgttcaaagacttcggtggccgctttatggcacagatgctggcggaa
gtggcgggcgatcagccggtgactatcctgacggcgacctccggcgataccggcgccgct
gtagcgcacgctttctacggcctgaagaacgtacgcgtggtcatcttgtatccgcagggc
aaaatcagcccgctgcaggaaaaactgttctgcaccctgggtggcaatatccacaccgtg
gcgatcgacggtgacttcgatgcttgccaggcgctggtgaaacaggcctttgacgatcag
gagctgaaagaggcgctgcacctgaactcggcaaactccatcaatatcagccgcctgctg
gcgcagatttgctactacttcgaagcggtggcgcaattgccgcaggaagcgcgcaatcaa
ctggtgatctcggtgccaagcggcaacttcggcgatctgaccgccggtctgctggccaag
tcgctgggcctgccggtgaagcgttttatcgctgccaccaatgccaacgataccgtgccg
cgcttcctgaccaacggtcagtggcagccgcaggctacggtcgcgacgctgtcgaatgcg
atggacgtaagccagccgaacaactggccgcgggtggaagagctgttccgtcgtaaaatc
tggcagttgaaagatctgggccacgctacggtgagcgatgaaaccaccagggacaccatg
cgggagctggcgcaattggggtatctttcagaaccgcatgccgcgattgcttaccgcgct
ctgcgcgatcaactgcgggaaggggagtttggtttgttcctcggcaccgcgcatccggcc
aagttcaaagagagcgtagaagagatcctcggccaggaactgccgctgccgaaggcgctg
gcactgcgtgccgatttgccgctgctgtcccacagcctgccggccggtttcgccgagttg
cgtaaattcctgatggctctgccggcctga

DBGET integrated database retrieval system