KEGG   Serratia sp. AS13: SerAS13_1236Help
Entry
SerAS13_1236      CDS       T02012                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sra  Serratia sp. AS13
Pathway
sra00020  Citrate cycle (TCA cycle)
sra00190  Oxidative phosphorylation
sra00650  Butanoate metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
Module
sra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS13_1236
   00650 Butanoate metabolism
    SerAS13_1236
  Energy metabolism
   00190 Oxidative phosphorylation
    SerAS13_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEG27033
Position
1352013..1352360
Genome map
AA seq 115 aa AA seqDB search
MVNNVSALGRNGVHDWLLLRASAIVITLYVLYILGFFVTAPDLTYEIWRGFFATSITKVF
TLLTLLSILVHAWVGLWQVLTDYVKPLAVRLVLQLAIVVVLLVYLLYGTIVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtttctgcattagggcgcaacggcgtacacgactggttgttactgcgt
gcttccgctatcgtcatcaccctgtacgtgctgtatatcctgggcttcttcgttacggct
ccggatctcacctatgaaatctggcgcggcttcttcgccacctctattacgaaagtgttc
acgctgctgacgctgctgtcgattctggttcacgcctgggtcggtttgtggcaggtgctg
acggactacgtcaaaccgctggcagtgcgtctggtgttgcaactggcgatcgttgtcgtg
ttgctggtctatttactgtacggaacaatcgtagtgtggggtgtgtaa

DBGET integrated database retrieval system