KEGG   Serratia sp. AS13: SerAS13_1240Help
Entry
SerAS13_1240      CDS       T02012                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sra  Serratia sp. AS13
Pathway
sra00020  Citrate cycle (TCA cycle)
sra00310  Lysine degradation
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
Module
sra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS13_1240
  Amino acid metabolism
   00310 Lysine degradation
    SerAS13_1240
Enzymes [BR:sra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SerAS13_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEG27037
Position
1358083..1359303
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAI
VEEEGATVLSRQILGRIRPGDSSGKPTEEKSQAKEATPAQRATASLEEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEAHLANGKKADKPAAAAVEAAPQPALSNRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRFPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDVDSMSMADIEKKI
KELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVN
GQVVIQPMMYLALSYDHRLIDGKESVGYLVTVKEMLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcctgaccttcctgaatcggttgccgatgcgaccgta
gccacctggcacaagaaaccaggcgacagcgtccagcgtgacgaagttctggttgaaatc
gaaactgacaaagttgtgttggaagtgccggccagcgaagcaggtattcttgatgcgatc
gtggaagaagagggcgcaaccgtgctttctcgccagatcctcggccgtattcgcccgggc
gatagctctggcaagccgaccgaagagaaaagccaggctaaagaagccactccggcacag
cgcgcaaccgccagcctggaagaagagagcaacgatgcactcagcccggcgatccgccgt
ctgattgccgaacacgatctcgatgctgcagccatcaaaggcagcggcgtgggtggccgc
atcactcgcgaagacgtggaagcgcatctggctaacggcaagaaagccgacaagccggcc
gcagctgcagttgaagccgcaccgcagcctgccctgagcaaccgcagcgaaaaacgcgtg
ccgatgacccgtctgcgcaagcgcgtggcagagcgtttgttggaagcgaagaacagcact
gcgatgctgactaccttcaatgaaatcaacatgcagccgatcatggacctgcgcaagcag
tacggtgaagctttcgaaaaacgccacggtgtacgtctgggcttcatgtccttctacatc
aaggcggtggttgaagcgctgaaacgcttcccggaagtgaacgcttccattgatggtact
gatgtggtctaccacaactatttcgatatcagcattgcggtatctaccccacgcggcctg
gtgaccccggtactgcgcgatgtagacagcatgagcatggcggacatcgagaagaaaatc
aaagagctggcggtcaaaggccgtgacggcaaattgaccgtggaagaactgaccggcggt
aacttcaccattaccaacggcggcgtattcggttcactgatgtctaccccgatcatcaac
ccaccgcagagcgcgatcctgggcatgcacgccattaaagatcgcccaatggcggtgaat
ggccaggttgtgatccagccaatgatgtatctggcactttcttacgatcaccgcttgatc
gacggcaaagagtccgttggttacctggtgacggtgaaagagatgctggaagatccggct
cgtctgctgctggacgtataa

DBGET integrated database retrieval system