KEGG   Serratia sp. AS13: SerAS13_1530Help
Entry
SerAS13_1530      CDS       T02012                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sra  Serratia sp. AS13
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS13_1530
Enzymes [BR:sra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SerAS13_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642227..1642892
Genome map
AA seq 221 aa AA seqDB search
MTSLSKEAALVHAALEERGLETPLRGEVLDRETRKRRIKEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDAVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaagtaaagaagctgccctggttcacgcagcgctcgaagagcgtggtctg
gaaaccccgttgcgcggtgaagtgctggatcgcgaaacgcgcaaacgtcgtattaaagag
cacatgacggaaatcatgcagctgcttaatctcgacctgtccgacgacagcctggcagaa
accccgcaccgcattgccaaaatgtatgtcgatgagattttctccggcctggactacgcc
aacttcccaaaaatcaccgttatcgaaaacaagatgaaggtagatgaaatggtgacggtg
cgcgatatcacactgaccagcacctgcgagcatcacttcgtgaccatcgacggcaaagcg
accgtggcctatattccgaaagatgcggtgattggtctgtcgaaaatcaaccgtatcgtg
cagttcttctcccagcgcccccaggtgcaggagcgtttgactcagcagatcctggtggca
ttgcaaaccttgctcggcaccaataacgtggcggtatcgattgatgcggtccattattgt
gttaaggcacgcggcatccgtgacgcgaccagcgccaccaccaccacctctctgggcggg
ctgttcaagtccagccagaacacgcgccaggagtttttgcgcgcggtacgtcatcaccag
gggtga

DBGET integrated database retrieval system