KEGG   Serratia sp. AS13: SerAS13_1873Help
Entry
SerAS13_1873      CDS       T02012                                 

Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sra  Serratia sp. AS13
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS13_1873
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SerAS13_1873
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SerAS13_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023534..2024565
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFTRNFHDAQQLRELVRQIREASHDRLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALNEAHEGGRLAQEAGWLMAAEMIAQDIDISFAPV
LDIGHVSAAIGERSFHSDPQQALAMAERFILGMHSAGMKTTGKHFPGHGAVSADSHKETP
RDPRPLAQIREHDMAIFRELINRQLLDAVMPAHVIYTEADPRPASGSPYWLQQILRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPVKADRV
KQLYHRGQFTRQELRDSARWQQAHKELSALSERWEEHKQQSAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttagatgtcgccagctatgagctggatgccgaagaacgtgagatt
ttaaaacacccgctggtgggcggacttatcctgttcacccgcaacttccacgatgcgcag
cagttgcgtgaactggtgcgccaaatccgcgaggcttcacacgatcggctggtggtggcg
gtggatcaggaaggcgggcgcgtccagcgtttccgcgaagggttcacccgcctgccggcg
gcgcagtcgttcgctgcattgaacgaagcccatgagggcgggcgtctggcgcaagaggcc
ggctggctgatggcggcggaaatgatcgcgcaggatatcgacatcagcttcgcgccggtg
ctggatatcggccacgtcagcgcggcgattggcgaacgctcattccacagcgatccgcaa
caggcgctggcgatggccgagcgttttatcctgggtatgcacagcgccgggatgaaaacc
accggcaagcatttccctggccatggcgccgtcagtgcagattcacataaagaaaccccg
cgcgatccacgcccactggcgcagatccgtgagcatgatatggcgatcttccgtgaattg
atcaaccgtcagttgctggacgccgtgatgccggcgcacgtcatctatactgaagcggac
ccgcgtccggccagtggttcgccatactggttgcaacaaatcctgcgtcaggagctgggc
tttgacggcgttatcttctccgacgatctgtcgatggaaggggccgccatcatgggcagt
tatgctgagcgcggccaggcatcgctggatgccggctgtgacatgatcctggtgtgcaat
aaccgccagggtgcggtcagcgtgctggataacctgtccccggtcaaagcagaccgggtg
aagcagttatatcatcgcggtcagttcacccgtcaggaattgcgtgattctgcgcgctgg
cagcaggcgcataaagagctgagcgcgctcagcgaacgctgggaagagcataagcagcaa
agtgccgggtga

DBGET integrated database retrieval system