KEGG   Serratia sp. AS13: SerAS13_2027Help
Entry
SerAS13_2027      CDS       T02012                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sra  Serratia sp. AS13
Pathway
sra00052  Galactose metabolism
sra00500  Starch and sucrose metabolism
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS13_2027
   00500 Starch and sucrose metabolism
    SerAS13_2027
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SerAS13_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEG27810
Position
complement(2176990..2178432)
Genome map
AA seq 480 aa AA seqDB search
MNNALAQADHAVETLRAQRQDDYYPQFHLAPAAGWINDPNGLVYINGVYHAFYQHHPYDE
NWGPMHWGHAISRDLAHWQHQPIALAPGDDYDKDGCFSGCAVDDNGVLTLIYTGHVWLDK
VGDDDQVREVQCLATSEDGVHFVKHGPVLAPPEGIQHFRDPKVWRESDGWWMVVGAKQNG
LGQARLYRSKDLRDWQFDRVLDGAQTLHQGYMWECPDFFPLGEKQVLLFSPQGLAAQGYR
HRNRFQSGYLLGHWQPGADFNVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHGWAGALTLPRELTLNAEGDVLMNPARELAALRGIPQTFAAAQLRNQRQLLAENV
QELTLSLDLAASDAERYGIAIGNAARLYVDNQAHRLVLERFSEEPGLCGCRSVPLPAGDT
LSLSVFIDRSSLEVFVNQGVACLTSRIYPTDGLRSVSLFAESGQAQFGALQGWELKSIWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgccttagctcaagccgaccatgcggtcgaaaccctgcgcgcacagcgtcag
gacgattactacccgcaatttcatctggcgcctgccgccggctggatcaacgatcccaat
gggctggtgtacattaacggcgtttatcatgcgttctatcaacaccacccctacgacgaa
aactggggaccgatgcactggggccacgccatcagccgggatctggcgcactggcagcac
cagccgatagccctggcgcccggcgacgactacgacaaagacggctgtttctccggctgc
gcagtggacgataacggcgtgctgacgctgatctacaccggccacgtctggctggacaaa
gtgggcgatgacgatcaggtacgtgaggtacagtgcctggccaccagcgaggacggcgta
catttcgtcaagcacgggccggtgttggcgccgccggaaggcattcagcatttccgcgat
cccaaggtctggcgcgagagtgacggctggtggatggtggtcggcgccaaacaaaacggc
ctcgggcaggcacggctttatcgttcaaaagatctgcgtgactggcagtttgaccgcgtg
ctggacggcgcgcagacgctgcatcagggctatatgtgggagtgcccggatttcttccct
ctcggcgaaaaacaggtgctgctgttctcgccgcaggggctggcggcgcagggctaccgc
caccgtaaccgcttccagagcggctatttgctcggtcactggcagccgggcgctgatttc
aacgtcactcaacctttctgcgaactggacgccgggcatgatttctatgcgccgcaaacc
tttaccgccgccgacggtcgccgcctgctgttcgcctggatggacatgtgggaatcgccg
atgccgagcaaggcgcacggttgggccggcgcgcttaccctgccccgcgaactgacgctg
aatgccgaaggcgatgtgctgatgaacccggcgcgggagttggcggcgctgcgcggcata
ccgcagacgtttgccgcagcgcaactgcgcaaccaacgccagcttctggcggagaacgtg
caagagctgacgctgtcgctggatctggccgccagcgatgccgaacgctacggtatcgcc
attggcaacgccgcgcggctgtacgtggacaaccaggcccacaggctggtgttggagcgt
ttcagcgaggaaccgggtctgtgcggttgccgcagcgtgccgctgccggcgggcgacacg
ctgtcgctgagcgtgtttatagaccgttcatcgctggaagtgttcgtcaatcagggcgtt
gcctgcctgaccagccgcatctacccgaccgatggcctgcgcagcgtgagcctgtttgcc
gaaagcggccaggcgcagtttggcgcgctacaggggtgggaactgaaaagcatctgggcc
tga

DBGET integrated database retrieval system