KEGG   Serratia sp. AS13: SerAS13_2179Help
Entry
SerAS13_2179      CDS       T02012                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sra  Serratia sp. AS13
Pathway
sra00511  Other glycan degradation
sra00600  Sphingolipid metabolism
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SerAS13_2179
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SerAS13_2179
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SerAS13_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AEG27962
Position
complement(2335281..2336606)
Genome map
AA seq 441 aa AA seqDB search
MNIEWITSSDTEQWQKCDRLLETIKPANLQLSKLRGRQVEGFGGCFNELGMTALNALDDK
QRHDILDNLFSPEGECRLTLGRVPIGASDYAVSWYSLNEQEEDYAMEHFSIERDKRYLLP
YIKEALARQPNMTLFASPWSPPTWLKTHQACNFGRLRRDERAQKAYALYFKKFIEHYEKE
GVRIAQVHIQNEVVADQKFPSCVWSGEQLKEFIKEYLGPLLMQEPIDSEIWLGTINAPEF
LKEPGQDYDDYANCVLSDPEAYQYVSGVGYQWAGKNAIQRTVMSYPELRYYQTESECGDG
NNSWQYAHYIFGLFRHYLINGANGYFYWNMVLAEGGESTWGWKQNSMISINKETKSVSYN
PEYSVMRHFSRYVVPGARLIPLTGAMSGNAVAFENPDNSVIITINNPSFHKRELRLAIGG
RTVEFTLHENSISTLIVKDYH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatggatcacatcatctgatacggaacaatggcagaaatgcgaccgtctt
ctagaaacaattaaacccgctaacctgcagctgtccaagctccgtggtcgtcaggtggaa
gggttcggcgggtgcttcaatgaactggggatgacggcgttaaatgctctggacgacaaa
cagcggcacgacatcctggataacctgttttcgccagagggtgaatgtcggcttaccctg
ggacgcgtaccgatcggcgcaagtgattatgccgtatcctggtatagcctcaatgaacaa
gaggaagattacgccatggaacacttttccattgagcgtgacaaacgttatttattgcct
tatataaaagaggcacttgcgcgtcagccaaacatgacgctttttgcctccccctggagc
ccacccacctggctgaaaacacaccaagcctgtaattttggccgtcttcgccgggatgaa
cgggcgcaaaaagcttacgcattatattttaaaaaatttatcgaacactatgagaaagaa
ggtgtgcgcatagcgcaggtacatattcaaaatgaagttgtcgccgatcaaaagttcccc
tcttgtgtctggagcggcgagcagttgaaagagtttataaaagagtatcttggcccactc
ttaatgcaagaacccatagacagcgagatctggttaggaaccatcaatgctccggaattt
ttgaaagagccgggacaagactatgatgactacgccaactgtgtactttccgaccccgaa
gcctaccaatatgttagcggcgtgggttatcagtgggccggtaagaatgccattcaacga
accgtaatgagttaccctgaattacgctattaccaaacagaaagtgaatgtggtgatgga
aataatagctggcagtacgcgcactatatttttggtttgttccgacattacttaatcaat
ggtgccaacggctacttttactggaacatggtgttggctgaagggggggaaagtacctgg
ggttggaagcaaaacagtatgatctccataaataaagaaacaaaatcagtaagttataat
ccagaatatagcgttatgcgtcacttttctcgatacgttgtacctggtgcccggctaata
ccattaaccggtgcaatgagtggtaatgccgttgcgttcgaaaaccctgataactcggtc
atcatcacgataaataacccttcatttcataaaagagaactgaggcttgccattggggga
agaaccgttgagtttacccttcatgaaaactcgataagtacattaatagtaaaagattac
cattaa

DBGET integrated database retrieval system