KEGG   Serratia sp. AS13: SerAS13_2213Help
Entry
SerAS13_2213      CDS       T02012                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sra  Serratia sp. AS13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS13_2213
   01230 Biosynthesis of amino acids
    SerAS13_2213
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2213
   00030 Pentose phosphate pathway
    SerAS13_2213
   00051 Fructose and mannose metabolism
    SerAS13_2213
   00052 Galactose metabolism
    SerAS13_2213
  Energy metabolism
   00680 Methane metabolism
    SerAS13_2213
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SerAS13_2213
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SerAS13_2213
Protein phosphatases and associated proteins [BR:sra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SerAS13_2213
Messenger RNA biogenesis [BR:sra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SerAS13_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2372715..2373695)
Genome map
AA seq 326 aa AA seqDB search
MKIGMVISGGDVTGINNFIFQVARLAQADIVLFNGGIPGLLANQHHSIARRDLVDFSISS
MPIISSGRTAKKLVASEYETIGKQLKALHIDVLIMAGGDGSLQFLNTLSEFGVNCFGVGM
TIDNDVFGSYYTIGFSTACEQVIKEVSKLRNTGRALPGRVFMIELLGGYCGELTLQSAIK
SNADFALIPECQHPLNALAEKITHRLERQNSVIILCSEGYTKEYSPGFQGAIDTMIKQLE
PKIGVRIRKTIVGYGLRNGDPTCEEIYQGTLMASEVVRCIHSGMKNKAIIINAGNQPIPI
DLISMQKRLVDTEGHHYKLARQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcatggtaataagcggtggcgatgtcaccggcatcaacaactttattttc
caggtcgccaggctggcgcaggcagatatcgttctgtttaacggcggaataccgggttta
ctggctaatcagcatcattccatcgccagacgcgacctggtcgatttctctatttcatcg
atgcccattatctcttctggtcgtacggcaaagaaactggtcgccagtgaatatgaaact
atcggcaagcaacttaaagctctgcacattgacgtgcttattatggccggcggcgacggc
tcgctgcagtttttaaatacgctcagtgagtttggcgttaactgttttggcgtgggcatg
accatcgacaatgacgtttttggtagctactacaccatcggtttttccaccgcctgcgag
caggtgataaaagaagtctccaagctgagaaataccgggcgcgccctgccgggccgcgta
tttatgattgagctgctgggcggttactgcggggagctaacgctgcaatcggcgataaag
tccaatgcggactttgccctgattccagaatgccaacatcctttgaacgcattggcggaa
aaaataacccaccggctggagcggcaaaacagcgttatcattttatgttcagagggatat
accaaagagtattcgccaggcttccagggggcgatcgacaccatgattaaacagctggaa
cccaagattggcgtgcgcattcgcaaaaccatcgtggggtacggtctgcgcaatggcgat
cccacctgtgaagaaatctatcagggaacccttatggccagcgaagtcgtgcgctgtatt
cattccggaatgaaaaacaaggcaatcattattaatgccggcaaccaacctattccgatt
gatttaatcagcatgcaaaaacgtttggtcgacaccgaaggacaccattacaaactcgcc
aggcagttaaatataatctga

DBGET integrated database retrieval system