KEGG   Serratia sp. AS13: SerAS13_2352Help
Entry
SerAS13_2352      CDS       T02012                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sra  Serratia sp. AS13
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS13_2352
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SerAS13_2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525531..2527591
Genome map
AA seq 686 aa AA seqDB search
MNKFPPLSAKVPGLLHGADYNPEQWANYPGMVEKDVELMTQANCNIMSVGIFSWSKLEPE
EGKYQFAWLDEVLNKLYAQGIHVFLATPSGARPAWLSQKYPEVLRVGRNRVPALHGGRHN
HCLSSPVYRRKVNEINLALAQRYAHHPAVIGWHISNEYSGECHCSRCQSDFRDWLQQRYQ
TLDRLNEAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFCSTQATDFCAQEIAP
LKAANPDLPATTNFMEYFYDYDYWQMSKVIDFISWDSYPMWHNRQDETGLACYTAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPISKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHSGRLDTRVGKEVSELGRLLTAMAPVAGSRVEARVAIIFDWESRWAMDDA
QGPRNAGLHYEQTVVEHYRPFWEQGIAVDIINADCDLSGYKLVIAPMLYMVREGFAARAE
AFVRQGGQFVASYWSGIVDESDLCHLGGFPGPLRPLLGIWAEEIDSLTDDETNSIRGVPG
NELGLQGSYQARHLCELINLEGATAQAVYGGDFYAGRPALTVNRFGDGKAWYVASRNDAS
FQRDFFMAIAQQLALPRALDTVLPTSVTAQRRTDGESEFIIVQNYSDKAKTVALPAVYTD
MSNAKTLQGEMTLAPWGCRLLTRKLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttcctcctttgagtgcaaaggtgcctggcctattgcatggagcagactac
aacccggaacaatgggctaattatccgggcatggtggagaaagatgtagagctgatgacg
caggctaactgcaatattatgtcggtagggatattcagctggtcgaagcttgaacctgaa
gagggtaaatatcaattcgcgtggttggacgaggtgctgaataagttatatgcgcagggt
attcacgtatttttggctacgccaagcggcgcgcgtccggcgtggttgtcgcagaaatac
ccggaggtattacgcgtggggcgcaatcgggtacccgcgttgcacggtggccgacacaac
cattgcctgtcatccccggtgtatcgtcgcaaggtgaatgagatcaacctggcgttggct
cagcgctatgcgcaccacccggcggtgatcggctggcatatttccaacgaatacagcggc
gaatgccattgcagccgttgccagagcgatttccgcgattggttgcagcagcgttatcag
acgctggatcggttgaacgaggcctggtggagcgatttctggagccacacctacagtgat
tggtcgcagattgaatcgcccgcgccgcagggtgaggtgtcgattcacggtctgaacctg
gactggcggcgtttttgcagcacccaggccaccgatttctgcgcgcaggaaattgcgccg
ctgaaggcggccaatccagacttgccggccaccaccaactttatggaatatttctacgat
tacgattactggcagatgtcgaaagtcatcgatttcatctcctgggacagctacccgatg
tggcataaccggcaggacgaaaccggcctggcctgctataccgccatgttccacgatcta
atgcgcagcctgaaacagggcaagccttttgtgctgatggaatcgacgccgagcgtcacc
aactggcaaccgatcagcaagctgaagaaaccgggcatgcatattctctcctcactgcag
gcggttgcgcacggagcggattcggtgcagtacttccagtggcgcaaaagccgcggctcg
gtggagaaattccacggtgcggtgattgaccattccgggcggctggatacccgcgtcggc
aaggaggtgagcgagctgggtcggttgttgaccgccatggcaccggtcgccggtagccgg
gtcgaggcgcgggtggcgattatcttcgactgggaaagccgctgggcgatggacgatgcc
caagggccgcgcaacgccgggctgcattacgagcagacggtggtggagcattatcgtccg
ttctgggagcagggcatcgcggtggatatcatcaacgccgattgcgatctctctggttat
aaactggtgattgcgccaatgctgtatatggtgcgcgaaggttttgccgcgcgtgcggaa
gcctttgtccggcagggcgggcagtttgtcgccagctactggagcggcatcgtcgatgaa
agcgatctgtgccatctgggcggtttcccgggaccactgcggccgctgctggggatctgg
gcggaagagatcgacagcctgacggatgacgagaccaacagtattcgcggcgtgccgggc
aatgagctgggtttgcagggcagctatcaggcgcgccatctgtgcgagctgatcaacctg
gagggcgccaccgcgcaggcggtctacggcggtgatttttatgccggccgcccggcgttg
acggtcaaccgctttggcgacggcaaggcgtggtatgtcgcttcgcgcaacgatgcctca
ttccagcgtgatttctttatggcgatagcgcaacagctggcgttgccgcgcgcactggac
acggtattgccgacgagcgtaaccgcacagcggcgcaccgacggtgaatccgagttcatt
atcgtgcagaactacagcgacaaggcaaaaaccgtggcgttgccggcggtgtataccgat
atgtcgaatgccaagactctacagggcgaaatgacgttggccccctggggctgccgccta
ttgacccgcaagttggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system