KEGG   Serratia sp. AS13: SerAS13_2384Help
Entry
SerAS13_2384      CDS       T02012                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sra  Serratia sp. AS13
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SerAS13_2384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2384
  Lipid metabolism
   00071 Fatty acid degradation
    SerAS13_2384
  Amino acid metabolism
   00350 Tyrosine metabolism
    SerAS13_2384
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SerAS13_2384
   00626 Naphthalene degradation
    SerAS13_2384
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SerAS13_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2554284..2555309)
Genome map
AA seq 341 aa AA seqDB search
MKTMKAAVVTAFGQPLVIKEVPIPEVAPGKILVKIAATGVCHTDLHAADGDWPIKPNPPF
IPGHEGSGHVVAVGAGVTHVKEGDRVGVPWLYSACGHCEHCLGGWETLCHSQQNSGYSVN
GSFAEYCLADANYVGILPDNVDFLSISPILCAGVTVYKGLKMTNTKAGDWVVISGIGGLG
HLAIQYATAMGLNVAAVDIDDDKLAFAKSLGASVVANARNVDPGRFFHQEFGGAHGVLVT
AVSPKAFEQATTVMRRGGTMVLNGLPPGSFDLSIFNMVLEGTTVRGSIVGTRKDLQEALD
FAGRKKVAATISVEPLEQINDIFSRMREGKITGRVVVDMSL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatgaaagctgctgtggtgactgcgtttggacaaccgttggtgattaaagag
gtcccgatcccggaggtcgcgcccggaaaaatcctggtcaagattgccgccaccggggtg
tgccataccgatctgcacgcagccgacggtgactggccgatcaaacccaacccgcctttt
attcctgggcatgagggctccggtcacgtcgtggcggtgggcgccggcgttacccacgta
aaagagggtgatcgcgtaggggtgccctggctttactctgcctgcgggcactgtgaacac
tgtctcggcggctgggaaacgctgtgccattcccagcaaaactcgggctattcggttaac
ggcagctttgccgaatactgcctggccgatgccaattacgtgggtattctgcccgataac
gtcgattttctgtctatctcaccgatcctctgtgccggcgtcaccgtctataaggggctg
aaaatgaccaataccaaggccggcgactgggtggtcatttccggcatcggcggtcttggg
catctggcgatccaatacgccaccgctatggggttgaacgtggcggcggtcgatattgac
gatgacaaactggccttcgccaaaagtctgggcgcttcggtggtagctaacgcgcgaaac
gtcgatcctggccgctttttccatcaggagttcggtggcgcgcacggcgtgctggtgacg
gcggtatcgccaaaggcatttgaacaggcgaccaccgtgatgcgacgaggcggcaccatg
gtattgaacggcctgccgccaggcagttttgacctttcaatcttcaatatggtgctggaa
ggcacgacggtgcgcggttcgattgtcggtacgcgcaaggatctgcaagaggcactggac
tttgccggccgtaagaaagtcgcggcaaccatctcggtagagccgctggagcaaatcaac
gacatcttcagccgcatgcgtgagggcaaaatcaccggccgcgtggtggtggatatgtcg
ctttaa

DBGET integrated database retrieval system