KEGG   Serratia sp. AS13: SerAS13_2484Help
Entry
SerAS13_2484      CDS       T02012                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sra  Serratia sp. AS13
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2484
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SerAS13_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2669239..2670675
Genome map
AA seq 478 aa AA seqDB search
MKQQQLPKDFLWGGAVAAHQVEGGWDQGGKGPSIADVLSGGSHGVDRVMTDGVLEGYSYP
NHEAVDFYGRYKQDVALFAEMGFKCFRTSIAWTRIFPKGDELEPNEAGLQFYDDLFDELL
KYNIQPVITLSHFEMPYHLVKEYGGWKNRQVVDFFVRFSEVVLRRYQHKVKYWMTFNEIN
NQSNYQYPLFGYCCSGVVYSEEQNPEQTLYQVLHHQFVASAQVVKLGHQINPEFKIGCML
ACVPFYPFSCKPDDVMYSVEAMHQRYLFTDVQVRGYYPSYLLRDWQRKGFQIEMQPQDEQ
TLREGCADYIGFSYYMSNALQADAPSSSDAMFGFPGNVPNPHVKASDWGWQIDPVGLRYS
LNVLYERYQKPLFIVENGFGAFDKVEADGQINDDYRIDYLSAHIEQMKKAVIEDGVDLIG
YTPWGCIDCVSFTTGEYGKRYGFIYVDKHDDGTGTLERSRKKSFDWYRNVIASNGEQL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaacagttaccgaaagattttctgtgggggggcgccgtcgccgcgcaccag
gttgaaggcggttgggatcagggcggtaaaggcccaagcattgccgacgtgttgtcgggc
ggctcgcacggcgtggaccgcgtgatgaccgatggcgtgctggaaggttatagctacccg
aaccatgaagccgtggatttctacggccgttataagcaggacgtggcgctgtttgccgaa
atgggcttcaaatgcttccgcacctcaatagcctggacgcgcatcttccctaaaggggat
gaactggagccgaacgaagccggcctgcaattctacgacgatctgttcgatgaactgctg
aaatacaacattcaaccggtgatcaccctgtcccactttgaaatgccttatcacctggtg
aaggaatacggaggctggaaaaaccgccaggtggtggatttcttcgtgcgtttcagtgaa
gtggtgctacgccgctatcagcacaaagtgaaatactggatgacctttaacgagatcaac
aaccagagcaactaccagtatccgctgtttggttactgttgctcgggtgtggtgtacagc
gaagagcagaatccggagcaaacgctgtatcaggtattgcaccatcagttcgtcgccagt
gcgcaggtagtgaaactcggtcaccagattaacccggaattcaagatcggctgcatgctg
gcctgcgtgcccttctatccgttctcctgcaagccggacgacgttatgtacagcgtcgag
gcgatgcaccagcgttacctgttcaccgacgtgcaggtacgcggttactacccgtcttac
ctgctgcgtgattggcagcgcaagggcttccagattgaaatgcagccgcaggacgagcaa
accctgcgcgaaggttgtgcggactacatcggtttcagctactacatgagcaacgccctg
caggcggatgcgccaagcagcagcgacgccatgttcggcttcccgggcaacgtgccgaac
ccgcacgttaaagcctccgactggggctggcagattgacccggttgggctgcgttattcg
ctgaacgtgttgtatgaacgctaccagaaaccgctgtttatcgttgagaacggttttggc
gcctttgataaagtagaggccgacggccaaatcaacgacgactatcgcatcgactacctg
agcgcgcatatcgagcagatgaagaaagcggtgatcgaagacggcgtagatctgatcggt
tacaccccgtggggctgtatcgactgcgtgtccttcactaccggtgagtacggcaagcgt
tacggctttatctacgtcgacaagcatgacgacggcaccggcaccctcgagcgttcgcgc
aaaaagagctttgactggtaccgcaacgtgatcgccagcaacggcgagcagctttaa

DBGET integrated database retrieval system