KEGG   Serratia sp. AS13: SerAS13_2519Help
Entry
SerAS13_2519      CDS       T02012                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sra  Serratia sp. AS13
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sra00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sra00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sra00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2707416..2708777)
Genome map
AA seq 453 aa AA seqDB search
MATKIVLVGAGSAQFGYGTLGDIFQSKTLYGSEIVLHDINPTSLAVTEKTARDFLAAEDL
PFIVSATTDRKTALSGAEFVIISIEVGDRFALWDLDWQIPQQYGIQQVYGENGGPGGLFH
SLRIIPPILDICADVADICPNAWVFNYSNPMSRICTTVHRRFPQLNFVGMCHEIASLERY
LPEMLGTSFDNLTLRAAGLNHFSVLLEASYKDSGKDAYADVRAKAPDYFSRLPGYSDILA
YTRNHGKLVETEGSTERDALGGKDSAYPWADRTLFKEILEKFHHLPITGDSHFGEYIRWA
SEVSDHRGILDFYTFYRNYLGHVQPKIELKLKERVVPIMEGILTDSGYEESAVNIPNQGF
IKQLPAFIAVEVPAIIDRKGVHGIKVDMPAGIGGLLSNQIAIHDLTADAVIEGSRDLVIQ
ALLVDSVNDKCRAIPELVDVMISRQGPWLDYLK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaaatcgttttagtgggcgcaggcagcgcgcaattcggctacggcaccctg
ggcgatatcttccagagcaagacgctgtacggcagtgaaattgtgctgcatgacatcaac
ccaacctcgctggccgtgaccgagaaaaccgcccgtgacttcctggctgcggaagatctg
ccgtttatcgtcagcgccaccaccgatcgcaaaaccgcgctgagcggagcggagttcgtg
attatctccattgaagtgggcgaccgctttgccctgtgggatctcgactggcagatcccg
cagcagtatggcattcagcaggtgtatggtgaaaacggtggccccggcgggctgttccac
tcgctgcgcatcattccaccgatcctcgacatctgcgccgacgtggcggacatttgcccg
aacgcctgggtattcaactactcgaacccgatgagccgcatttgcaccaccgtgcatcgc
cgtttcccgcagctcaactttgtcggcatgtgccatgaaatcgcctcacttgagcgttat
ctgccagaaatgctcggcacctccttcgacaatctcactctgcgcgccgccgggctgaac
cacttcagcgtgttgctggaggccagctataaagacagcggcaaagacgcttacgccgac
gtacgcgccaaggcaccggactatttctcccgtctgccgggctacagcgatattctggct
tacacccgcaatcacggcaaattggtggagacagaaggcagcaccgaacgcgatgcgctg
ggcggcaaagacagcgcctacccgtgggcggaccgcacgctgttcaaagagatcctggag
aagtttcaccatttgccgatcaccggcgacagccactttggcgagtacatccgttgggcc
agcgaagtcagcgatcaccgcggtatcctcgatttctacaccttctaccgcaactatctg
gggcatgtgcagccaaaaatcgaactgaagctgaaagaacgcgtggtgccgatcatggaa
gggatcctcaccgattccggttatgaagagtctgcggtcaacattccgaaccagggattt
atcaagcaactgccggcgtttattgccgtcgaagtcccggcgattatcgaccgcaagggc
gtgcacggcatcaaggtcgacatgcctgcgggcatcggtggcctgttgagcaaccagatt
gcgattcacgatctgaccgccgacgcagtgattgaaggctcgcgcgacctggttatccag
gcgctgctggtggactcggtcaacgataaatgccgcgcgataccggaactggtggacgtg
atgatctcacgccaggggccgtggctcgattacctgaaataa

DBGET integrated database retrieval system